PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_006906-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 163aa    MW: 18409.8 Da    PI: 10.4195
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_006906-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.41.4e-3288142155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    k+r+rWtp+LH+rFve v++LGG+ekAtPk+i++lm+ +gLt+ hvkSHLQkYR+
  NNU_006906-RA  88 KTRIRWTPDLHKRFVESVNRLGGAEKATPKRIRKLMDSEGLTNFHVKSHLQKYRI 142
                    68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.99E-1786142IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.1E-2986143IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-2488143IPR006447Myb domain, plants
PfamPF002491.7E-792141IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
SYTNLPGIEL HPLLQPKLVG EDATFDSRNP SIPYERNQNH RVGYNPVTSL PLAQPSLHVQ  60
PEKRSLRPRG VSVASGSTVT SETETSSKTR IRWTPDLHKR FVESVNRLGG AEKATPKRIR  120
KLMDSEGLTN FHVKSHLQKY RIAKYIADLQ KPEGESFLET QKP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-2387145159Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-2387145159Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-2388145158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-2388145158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-2388145158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-2388145158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-2387145159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-2387145159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-2387145159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-2387145159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-2387145159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-2387145159Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010265860.11e-76PREDICTED: myb family transcription factor PHL5-like
SwissprotQ0WVU32e-27PHL5_ARATH; Myb family transcription factor PHL5
TrEMBLA0A1U8ASR32e-75A0A1U8ASR3_NELNU; myb family transcription factor PHL5-like
STRINGXP_010255682.11e-105(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.27e-30G2-like family protein