PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_006595-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 400aa    MW: 44780.4 Da    PI: 7.7478
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_006595-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like104.85e-33257312156
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    k+r++W+peLH+rFv+a++qLGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  NNU_006595-RA 257 KQRRCWSPELHRRFVNALQQLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 312
                    79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.8E-30254315IPR009057Homeodomain-like
PROSITE profilePS5129414.103254314IPR017930Myb domain
SuperFamilySSF466892.99E-18255315IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-27257312IPR006447Myb domain, plants
PfamPF002491.4E-7259310IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 400 aa     Download sequence    Send to blast
MGSTSPELSL DFKPWQAPKT ICCFLRELSA IEDIPERLSK LDEYIKKLEE EMKKIDAFKR  60
ELPLCMLLLD DAIITLKEHA MQCTTSDVRP VMEEFIPLKR NSDEDGAPKK ENDCRDKKNW  120
MSTAQLWSSN GYSNKDNCYD RNKKSTVDRK EVGEDDHSVP ENAFQPCKYR SRGGAFMPFK  180
GYSCFPATVV KEDKDVLPIS ALSLLTPGIR THSIEASPGY LNSKSIISSR VINSSSTKHH  240
TQSNLQNTLQ QQQSSRKQRR CWSPELHRRF VNALQQLGGS QVATPKQIRE LMKVDGLTND  300
EVKSHLQKYR LHTRRLPAVS PPANQPVVVL GGLWMPQDQY GPSPKPSTSQ SGSPQGPLQL  360
AGAAGGLSTT GGDSMEDDDD GRSESYSWKG HHQKSGEDDV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-14257310255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-14257310255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-14257310154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-14257310154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-14257310154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-14257310154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-14257310255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-14257310255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-14257310255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-14257310255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-14257310255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-14257310255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010255132.10.0PREDICTED: myb family transcription factor EFM-like
TrEMBLA0A1U7ZSU30.0A0A1U7ZSU3_NELNU; myb family transcription factor EFM-like
STRINGXP_010255132.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.13e-64G2-like family protein