PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_006543-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 322aa    MW: 36041.5 Da    PI: 7.0452
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_006543-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.26.9e-32126179255
        G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    pr+rWt++LH++Fv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  NNU_006543-RA 126 PRMRWTTTLHAHFVHAVELLGGHERATPKSVLELMNVKDLTLAHVKSHLQMYRT 179
                    9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.25E-15123180IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-28124180IPR009057Homeodomain-like
TIGRFAMsTIGR015573.4E-23126179IPR006447Myb domain, plants
PfamPF002492.1E-7127178IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0080060Biological Processintegument development
GO:0005618Cellular Componentcell wall
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MRTTLPFPDL SLQISPPTIP DCEGKDMSYH GWMRKPIYSD RTSTTDSGSS GSDVTHEQGF  60
LHLERAYDLR GSEPTLSLGF ETAAVDPPPM QLPRNLHYLH QPQIYGREFK RNSRMINGGK  120
RSIRAPRMRW TTTLHAHFVH AVELLGGHER ATPKSVLELM NVKDLTLAHV KSHLQMYRTV  180
KSTDKGAGQG QTELGLNQRS GVIEVDAGLS SCEKTDPNPY SLNPPLPKSP RGSWSSMETN  240
GWDPSTKESG LIPSHLKSTD LTNEKNKMDG ADFYVSHNES ERLYLSPLAS SHVLPNLEFT  300
LGRQSWEMDY ADPTNELTLL KC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-16127181458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-16127181458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-16127181357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-16127181357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-16127181357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-16127181357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-16127181458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-16127181458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-16127181458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-16127181458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-16127181458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-16127181458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00107PBMTransfer from AT5G42630Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010255045.10.0PREDICTED: probable transcription factor KAN4 isoform X1
TrEMBLA0A1U8A1R40.0A0A1U8A1R4_NELNU; probable transcription factor KAN4 isoform X1
STRINGXP_010255045.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42630.15e-69G2-like family protein