PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_006061-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 455aa    MW: 49416.8 Da    PI: 7.0864
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_006061-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.45.8e-32248303156
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  NNU_006061-RA 248 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 303
                    68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.355245305IPR017930Myb domain
SuperFamilySSF466895.02E-17245306IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.1E-28246306IPR009057Homeodomain-like
TIGRFAMsTIGR015571.2E-26248303IPR006447Myb domain, plants
PfamPF002497.9E-7250301IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 455 aa     Download sequence    Send to blast
MGSPAELSLD CKPHSYSLLL KSFGEQTDQT QKLEEFLYRL EEERLKIDAF KRELPLCMQL  60
LTNAMEASRQ QLQTYRTNQV SRPVLEEFIP LKHSASDQGL EKASTASEMA SWMTTAQLWS  120
QSSDGSKQQP ATAASAKEVG DQCFSVSPKL ALDSKQRNGG AFLPFSKERN TCASPTLRGL  180
PELALASTDK EMEDKKCSES DNAVSVSCSR RENSSKSNAG GTATTEQGKG GRNSAEPQPA  240
TTTQTHRKAR RCWSPDLHRR FVNALQMLGG SQVATPKQIR ELMKVDGLTN DEVKSHLQKY  300
RLHTRRPSPS PQAAGTPAPQ LVVLSGIWVP PEYATAAAAA AHPAAPTIYS AHPASHASTH  360
YCAPAVAQEF YPTPTHQLHH SLHHVYKASS QTHSSPESDG RPAGDGSESI EDGKSESSSW  420
NKGDSGDQNG GERKGLASLR DDGDESNGSE ITLKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A2e-13248301154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-13248301154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-13248301154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-13248301154Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010254263.10.0PREDICTED: myb family transcription factor EFM-like
SwissprotQ9ZQ851e-126EFM_ARATH; Myb family transcription factor EFM
TrEMBLA0A1U7ZLX00.0A0A1U7ZLX0_NELNU; myb family transcription factor EFM-like
STRINGXP_010254263.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-115G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]