PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_005646-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family S1Fa-like
Protein Properties Length: 89aa    MW: 9848.7 Da    PI: 10.3405
Description S1Fa-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_005646-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1S1FA1351.8e-422389470
           S1FA  4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
                   + +eakG+nPGlivllvv glllvflvgny+ly+yaqk+lPPrkkkPvskkk+kre+lkqGv++PGe
  NNU_005646-RA 23 KDAEAKGFNPGLIVLLVVVGLLLVFLVGNYALYMYAQKALPPRKKKPVSKKKMKRERLKQGVSAPGE 89
                   578***************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046893.2E-412589IPR006779DNA binding protein S1FA
ProDomPD0190130.0042889No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MAEDFEFSDK VPPSFEHGGN VMKDAEAKGF NPGLIVLLVV VGLLLVFLVG NYALYMYAQK  60
ALPPRKKKPV SKKKMKRERL KQGVSAPGE
Functional Description ? help Back to Top
Source Description
UniProtDNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010253578.16e-58PREDICTED: DNA-binding protein S1FA-like
SwissprotP425534e-16S1FA1_ORYSJ; DNA-binding protein S1FA1
TrEMBLA0A1U7ZY661e-56A0A1U7ZY66_NELNU; DNA-binding protein S1FA-like
STRINGXP_010253577.12e-57(Nelumbo nucifera)