PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_005317-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 310aa    MW: 34035.4 Da    PI: 6.7343
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_005317-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.62.8e-333690155
        G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                   kprlrWt +LHerFv+av+qLGG++kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  NNU_005317-RA 36 KPRLRWTADLHERFVDAVTQLGGADKATPKSIMRTMGVKGLTLFHLKSHLQKYRL 90
                   79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-323391IPR009057Homeodomain-like
PROSITE profilePS5129410.5263393IPR017930Myb domain
SuperFamilySSF466897.88E-173692IPR009057Homeodomain-like
TIGRFAMsTIGR015575.0E-243691IPR006447Myb domain, plants
PfamPF002491.3E-73889IPR001005SANT/Myb domain
PfamPF143796.7E-16131176IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MFPGLIQPHE AVVPQEEIQG SNHRGDPCLV LTSDPKPRLR WTADLHERFV DAVTQLGGAD  60
KATPKSIMRT MGVKGLTLFH LKSHLQKYRL GKQSGKDLTE PSKDASYLLE SPHNGTSSPG  120
MSASDLNEGY EVKEALRAQM EVQRKLHLQV EAEKHLQICK DAERRYVESM LERACKLLAG  180
QTISCLVPDA EGHELPGSAP KASRTSSSHE PTRFYSLRPA EAIRVQVPEE EPPNLQPPRA  240
DCSTESCLTT NGSPAGLSLE SSPAGCKKRV RSLDTTDALI WSEASTRTQD IDATRIDPHV  300
ITGYGRLGEI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-193689255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-193689255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-193689255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-193689255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-193689255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-193689255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-193689255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-193689255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Acts redundantly with PHR1 as a key component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). {ECO:0000269|PubMed:26586833}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010252936.10.0PREDICTED: protein PHR1-LIKE 2-like isoform X2
SwissprotQ94A572e-73PHL2_ARATH; Protein PHR1-LIKE 2
TrEMBLA0A1U7ZIQ30.0A0A1U7ZIQ3_NELNU; protein PHR1-LIKE 2-like isoform X2
STRINGXP_010252935.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.11e-75G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]