PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_005316-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 328aa    MW: 35883.4 Da    PI: 7.8247
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_005316-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1071e-3352106155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    ++rlrWt+eLHerFv+av+qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  NNU_005316-RA  52 RQRLRWTNELHERFVDAVTQLGGPDRATPKGVLRIMGVQGLTIYHVKSHLQKYRL 106
                    58****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.94549109IPR017930Myb domain
SuperFamilySSF466895.73E-1851106IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.3E-3251107IPR009057Homeodomain-like
TIGRFAMsTIGR015577.8E-2653107IPR006447Myb domain, plants
PfamPF002498.3E-954105IPR001005SANT/Myb domain
PfamPF143791.7E-10138174IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MFQPKAVPSS NLASSNLLVH AQNMDNSVSA VAHCSGGSSL NNNTNSSTIA SRQRLRWTNE  60
LHERFVDAVT QLGGPDRATP KGVLRIMGVQ GLTIYHVKSH LQKYRLAKYL PESTSDVKKS  120
EKKEPSELLS TISSSSGMQI TEALKLQMEV QRQLQLRIEA QGKYLKKIIE EQQRLSGFLG  180
ESNLMIPPPI SGSNFPESDK TDPSTPAPTS ECPLQNKAAQ ECAPAKSLSC NESISSYHEP  240
LTPDSVCHVT SPSESPKGER PLKQKRVGMD AVSAKPEMIL THQILESSLS SSFQQPCSGF  300
PIREQLDPSS GRSHCNGDQF ENVSLRDL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-2452109259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-2452109259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-2452109259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-2452109259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-2452109259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-2452109259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-2452109259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-2452109259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00252DAPTransfer from AT2G01060Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010252934.10.0PREDICTED: myb family transcription factor PHL7-like isoform X2
SwissprotQ9SJW01e-111PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A1U7ZMI30.0A0A1U7ZMI3_NELNU; myb family transcription factor PHL7-like isoform X2
STRINGXP_010252929.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-100G2-like family protein