PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_005315-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 313aa    MW: 34025.4 Da    PI: 10.0107
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_005315-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.91.7e-3155109155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    ++rlrWt+eLHerFv+av++LGG++kAtPk +l++m+v gLt  hvkSHLQkYRl
  NNU_005315-RA  55 RQRLRWTHELHERFVDAVAKLGGPDKATPKGVLRAMGVLGLTTFHVKSHLQKYRL 109
                    58****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.7452112IPR017930Myb domain
SuperFamilySSF466897.88E-1753110IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.4E-3054112IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-2456110IPR006447Myb domain, plants
PfamPF002493.5E-957108IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MHQPKSTSSS SLVRSNALLP RQHLNSTDSA MGSSSRGSII ETSNSSKNSP ILSTRQRLRW  60
THELHERFVD AVAKLGGPDK ATPKGVLRAM GVLGLTTFHV KSHLQKYRLA THHPELHGKM  120
GREARALVQL TEGSSKTDTL KVPTMALHWC TSSQIQKMDT LKLQAEVQKR LHEQLEASLF  180
KFVTGIFKVK FSLFPFVQRQ LEVGKEDNSK PPKITEEQKS SSDVLAEASG AVTSVPLLES  240
EKTEACTPSP TASDSAPTSN SPNQELETPA QVDASKEHPQ AKNASASKSS SPGESSGERV  300
VKKQRVSEGP ECA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-1955112259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-1955112259Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-1955112158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1955112158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1955112158Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1955112158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-1955112259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-1955112259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-1955112259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-1955112259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-1955112259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-1955112259Protein PHOSPHATE STARVATION RESPONSE 1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010252926.11e-171PREDICTED: myb family transcription factor PHL7-like
RefseqXP_010252928.11e-171PREDICTED: myb family transcription factor PHL7-like
TrEMBLA0A1U7ZWP11e-170A0A1U7ZWP1_NELNU; myb family transcription factor PHL7-like
STRINGXP_010252926.11e-171(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-44G2-like family protein