PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_005199-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 464aa    MW: 52723.9 Da    PI: 6.4601
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_005199-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding391.9e-1277118446
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      W ++E+ ll+++++++G g+W+ +a+++g +++  qc++++ +
    NNU_005199-RA  77 WNADEEILLLEGIEMYGLGNWAEVAEHVG-TKSKAQCIDHYTT 118
                      *****************************.**********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0250243.7E-12344461IPR016827Transcriptional adaptor 2
SuperFamilySSF466897.48E-1370123IPR009057Homeodomain-like
PROSITE profilePS5129322.24572124IPR017884SANT domain
SMARTSM007176.5E-1273122IPR001005SANT/Myb domain
PfamPF002492.5E-1276118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-877119IPR009057Homeodomain-like
CDDcd001677.17E-1277119No hitNo description
SuperFamilySSF466891.42E-15368456IPR009057Homeodomain-like
PROSITE profilePS509349.287375464IPR007526SWIRM domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0016573Biological Processhistone acetylation
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 464 aa     Download sequence    Send to blast
MASPHYTKAS ISEHKPALLP IRKLCTLCQP HLRNLVLPSD DYQPQQGISA TPPQISSSLV  60
FASLQDNLSF PLICPDWNAD EEILLLEGIE MYGLGNWAEV AEHVGTKSKA QCIDHYTTVY  120
MNSPCFPLPD MSHVVGKNRK ELLAMAKGHG EGKKDSRVDR SVGGKKPKTS VDEGPSIIEL  180
SGYNPKRQEF DPEYDNDAEQ SLAEMEFKDS DTEAERELKL RVLHIYLKRL DERKRRKDFI  240
LERKLLYPNP LEKELSPEEK EIYQQYKVFM RFISKEEYEE LIKTVIEEHR VRKRIQDLQE  300
ARAAGSHTSA DADKYIEQKR KKVAEESAHR AKEGALAGPS GKVLQKTNRP KGEPDGSPCG  360
GVKGSMELER GGKDLFTSIS SDEWDITCFP GSELLSEPDL RLCREIKLLP SHYLKMLEII  420
SVEIHRSNIT QKSDAYRFFK VESRKVDRVY DALVNGQVFE TSNG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6cw3_E3e-166913257120Transcriptional adapter 2
6cw3_G3e-166913257120Transcriptional adapter 2
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1232237RKRRKD
Functional Description ? help Back to Top
Source Description
UniProtRequired for the function of some acidic activation domains, which activate transcription from a distant site. The exact mechanism of action is not yet known. ADA2 and GCN5 function to acetylate nucleosomes, opening up the promoter region (By similarity). {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010252740.10.0PREDICTED: transcriptional adapter ADA2 isoform X5
SwissprotQ75LL61e-157TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLA0A1U7ZG740.0A0A1U7ZG74_NELNU; Transcriptional adapter
STRINGXP_010252736.10.0(Nelumbo nucifera)
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]