PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_004596-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 296aa    MW: 31966.9 Da    PI: 7.8939
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_004596-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.62.9e-3347101155
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                    k+rlrWt++LH+rFv+a++qLGG+++AtPk +l++m+v+gLt++hvkSHLQkYRl
  NNU_004596-RA  47 KQRLRWTSDLHDRFVDAITQLGGPDRATPKGVLRVMGVPGLTIYHVKSHLQKYRL 101
                    79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.3344104IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.6E-3246102IPR009057Homeodomain-like
SuperFamilySSF466893.94E-1746101IPR009057Homeodomain-like
TIGRFAMsTIGR015574.9E-2647102IPR006447Myb domain, plants
PfamPF002491.6E-749100IPR001005SANT/Myb domain
PfamPF143791.7E-24133179IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MYHAKKFSTM TLVPHKPQPQ GADQLPNVGV LGGSTINNSA TSGGTGKQRL RWTSDLHDRF  60
VDAITQLGGP DRATPKGVLR VMGVPGLTIY HVKSHLQKYR LAKYLPESPA DGSKDEKKDS  120
GDSLSSMDSA PGVQINEALR MQMEVQKRLH EQLEVQRQLQ LRIEAQGRYL QKIIEEQQKL  180
GGALKASEPL PLADEKQKQS TSVTAAAVEG PMSPLKKQRV DDGSSDPASS VLVPPPPSTE  240
KKSDFIGQWD GDLYGGNGVG FEFDVVNEFK EKEDGGAEQR ATSKVGTGYG TGGSIS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-2446104159Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-2446104159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-2446104159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-2446104159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-2446104159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-2446104159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-2446104159Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-2446104159Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010251692.10.0PREDICTED: myb family transcription factor PHL7-like
SwissprotQ9SJW02e-74PHL7_ARATH; Myb family transcription factor PHL7
TrEMBLA0A1U7ZTK70.0A0A1U7ZTK7_NELNU; myb family transcription factor PHL7-like
STRINGXP_010251692.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01060.11e-52G2-like family protein