PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_004037-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family TCP
Protein Properties Length: 244aa    MW: 25468.6 Da    PI: 9.6785
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_004037-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP128.56.6e-4049135288
            TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 
                    a+k+++++++hTkv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLlqqa+p+i+++tgt++++as+  a+  s+s++ ss +
  NNU_004037-RA  49 APKRSSNKDRHTKVDGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLQQAEPSIIAATGTGTIPASALAAAGGSVSQQGSSVS 135
                    789******************************************************************888444444444433333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.3E-3254141IPR005333Transcription factor, TCP
PROSITE profilePS5136928.0755109IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MDPKGSKQPQ EVPKFLSLPQ PDMGDNKPAE IKDFQIVIAE KDEGKKQLAP KRSSNKDRHT  60
KVDGRGRRIR MPALCAARIF QLTRELGHKS DGETIQWLLQ QAEPSIIAAT GTGTIPASAL  120
AAAGGSVSQQ GSSVSAGLHS KIDELGPGVG SGSRTNWSVM GSNLGRSHVA TGLWPSVGGF  180
GPGFVPASAP STSNLGTESS NYLTRIGFHG FELPGSNLGP VAFSSIMGGN NQHLPGCADG  240
TMQN
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds to the site II motif (3'-TGGGCC/T-5') in the promoter of PCNA-2 and to 3'-GCCCG/A-5' elements in the promoters of cyclin CYCB1-1 and ribosomal protein genes. {ECO:0000269|PubMed:12631321, ECO:0000269|PubMed:16123132}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010250638.11e-156PREDICTED: transcription factor TCP20
SwissprotQ9LSD51e-69TCP20_ARATH; Transcription factor TCP20
TrEMBLA0A1U7ZPP31e-155A0A1U7ZPP3_NELNU; transcription factor TCP20
STRINGXP_010250638.11e-156(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27010.14e-59TCP family protein
Publications ? help Back to Top
  1. Zhu P, et al.
    Arabidopsis small nucleolar RNA monitors the efficient pre-rRNA processing during ribosome biogenesis.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(42): p. 11967-11972
    [PMID:27708161]
  2. Wu JF, et al.
    LWD-TCP complex activates the morning gene CCA1 in Arabidopsis.
    Nat Commun, 2016. 7: p. 13181
    [PMID:27734958]
  3. Guan P, et al.
    Interacting TCP and NLP transcription factors control plant responses to nitrate availability.
    Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424
    [PMID:28202720]
  4. Guan P
    Dancing with Hormones: A Current Perspective of Nitrate Signaling and Regulation in Arabidopsis.
    Front Plant Sci, 2017. 8: p. 1697
    [PMID:29033968]
  5. Zhang N, et al.
    MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis.
    Plant J., 2018. 93(1): p. 66-78
    [PMID:29086441]
  6. Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C
    Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2018. 176(2): p. 1694-1708
    [PMID:29133375]
  7. Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K
    Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis.
    Microbes Environ., 2017. 32(4): p. 314-323
    [PMID:29187692]