PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_003614-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 457aa    MW: 49202.6 Da    PI: 7.016
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_003614-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.79.4e-32245300156
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  NNU_003614-RA 245 KARRCWSPDLHRRFVNALQILGGSHVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 300
                    68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.201242302IPR017930Myb domain
SuperFamilySSF466891.08E-16242303IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-28243303IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-26245300IPR006447Myb domain, plants
PfamPF002492.2E-6247298IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 457 aa     Download sequence    Send to blast
MGSPAELSLD YKPNSYSLLL KTFGDQTQNL EEILSRLEEE RIKIDGLKRE LPLCMQLLTN  60
AMEALRQQLQ TYRTNQGPRP VLEEFIPLKH SGSEGSEKAA SISEKVSWMT TAQLWSQSSD  120
GINKEQATVA SAKEGDHCFS VSPKLALDNK QRNGGAFLPF SKEKSSCATP TLSVLPELAL  180
ASTNKEMEDK KRSESDNGVS VSCSTRDNSC SKAAGGGGTP TTEKGNAGGN AAEAQPTATT  240
QTHRKARRCW SPDLHRRFVN ALQILGGSHV ATPKQIRELM KVDGLTNDEV KSHLQKYRLH  300
TRRPSPSPQV AGTPAPQLVV LGGIWVPPEY ATAAAAAAAH PAAASTIYGA HPASHPSTHY  360
CAPAVAQEFY PTPPHHQLHH SLHPQQHIYK ASSQTHSSPE SDGRPAGDGS ESIEDGKSEN  420
SSWKGDSGEN GGDRKGLGSM RDDGDDQSNG SEITLKF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-13245298255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-13245298255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-13245298154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-13245298154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-13245298154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-13245298154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-13245298255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-13245298255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-13245298255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-13245298255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-13245298255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-13245298255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010249933.10.0PREDICTED: myb family transcription factor EFM-like
SwissprotQ9ZQ851e-122EFM_ARATH; Myb family transcription factor EFM
TrEMBLA0A1U7ZPA60.0A0A1U7ZPA6_NELNU; myb family transcription factor EFM-like
STRINGXP_010249933.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.11e-110G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]