PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_002719-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family TCP
Protein Properties Length: 146aa    MW: 16075.3 Da    PI: 10.3978
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_002719-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP89.66.7e-28474373
            TCP  3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73
                    ++ ++++ hTkv+gR+ R+ +sa+  ar+F+L++eLG+++d++ti WLl+  +p i+ +tgts+ +  ++
  NNU_002719-RA  4 RRRASTKDWHTKVEGRGHRIWMSATYTARIFQLTRELGHKSDGETIRWLLKHTEPTIIPATGTSTVPTIAM 74
                   58999**********************************************************77666333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036342.3E-21892IPR005333Transcription factor, TCP
PROSITE profilePS5136918.91963IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 146 aa     Download sequence    Send to blast
MVTRRRASTK DWHTKVEGRG HRIWMSATYT ARIFQLTREL GHKSDGETIR WLLKHTEPTI  60
IPATGTSTVP TIAMSVGGIL KSPTTSLASD GDMTKKNRKR SVSSEYYDIS DGVSISSGLA  120
PIGAIAVPQQ LLRHYPITPP SDGWVE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010255575.19e-62PREDICTED: transcription factor TCP9
SwissprotO646475e-51TCP9_ARATH; Transcription factor TCP9
TrEMBLA0A1U7ZTX92e-60A0A1U7ZTX9_NELNU; transcription factor TCP9
STRINGXP_010255575.13e-61(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.12e-53TCP family protein