PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_002551-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family TCP
Protein Properties Length: 515aa    MW: 55937.2 Da    PI: 5.9339
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_002551-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP64.24.8e-2077138970
            TCP   9 skihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 
                     ++hTk  gRdRRvRl+a ca  +F L++eLG+++ ++ti WLl+q  p   +    ss++ 
  NNU_002551-RA  77 RDRHTKFQGRDRRVRLPAACAPGIFRLTQELGLKTGGETILWLLEQVRPDLVAPKTISSKKV 138
                    69***********************************************9887655533333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036347.3E-1775142IPR005333Transcription factor, TCP
PROSITE profilePS5136916.96776130IPR017887Transcription factor TCP subgroup
SuperFamilySSF563171.57E-66196480IPR003010Carbon-nitrogen hydrolase
Gene3DG3DSA:3.60.110.102.8E-70197480IPR003010Carbon-nitrogen hydrolase
CDDcd075649.53E-120198480No hitNo description
PROSITE profilePS5026340.725198503IPR003010Carbon-nitrogen hydrolase
PfamPF007954.1E-59199477IPR003010Carbon-nitrogen hydrolase
PROSITE patternPS009200230245IPR000132Nitrilase/cyanide hydratase, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006807Biological Processnitrogen compound metabolic process
GO:0016810Molecular Functionhydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
KSVSCLAPSR QPDSFHGSGL IKENPETEEC TLDLRTAAHV HENLQCIAMD VEIEPQPHED  60
EVQNTEKKKR RRPISGRDRH TKFQGRDRRV RLPAACAPGI FRLTQELGLK TGGETILWLL  120
EQVRPDLVAP KTISSKKVSQ ANSADDSVLV PEPISVAYPR DAVNGRFIDS APVSNGDEPV  180
MSIVKAETTD HPGPRPTIRA TVVQASTVFY DTRATLDKAE RLIAGAAAYG SQIVVFPEAF  240
VGGYPRSSCF DVAAGTYPNE GNMELQKYHA AAVEIPGPEI ERLAAIAGRY KVHLVMGVVE  300
REGFSLYCTV VFFNPHGEYL GKHRKLMRTA SEHTVWCSGD KSTPPVYETS IGKIGGLICW  360
DNRMPVLRTG LYARGVEIYC APTSDASDLW RSSLAHIALE GGCFILSANQ FCQRKDYPLP  420
GEHMPGDEKS DMPPDSVVCS GGSVIISPSG AILAGPNYQG ESLISADLDL EEITRAKLEF  480
NGGEAQCGTN SLALETSKSN TVPYAPSVKK DVTGE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3wuy_A1e-3419847716289Nitrilase
3wuy_B1e-3419847716289Nitrilase
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16572EKKKRRRP
26671KKKRRR
Functional Description ? help Back to Top
Source Description
UniProtHighly specific for beta-cyano-L-alanine (Ala(CN)). Low activity with 3-phenylpropionitrile (PPN). Not associated with auxin production but may be involved in cyanide detoxification. {ECO:0000269|PubMed:10574458, ECO:0000269|PubMed:11060302}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Not induced by abscisic acid or by 1-aminocyclopropane-1-carboxylic acid (ACC). {ECO:0000269|PubMed:10574458}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010246167.10.0PREDICTED: bifunctional nitrilase/nitrile hydratase NIT4B
SwissprotQ429661e-147NRL4B_TOBAC; Bifunctional nitrilase/nitrile hydratase NIT4B
TrEMBLA0A1U7Z2520.0A0A1U7Z252_NELNU; bifunctional nitrilase/nitrile hydratase NIT4B
STRINGXP_010246167.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G45150.19e-18TCP domain protein 16
Publications ? help Back to Top
  1. Dohmoto M,Sano J,Tsunoda H,Yamaguchi K
    Structural analysis of the TNIT4 genes encoding nitrilase-like protein from tobacco.
    DNA Res., 1999. 6(5): p. 313-7
    [PMID:10574458]
  2. Piotrowski M,Schönfelder S,Weiler EW
    The Arabidopsis thaliana isogene NIT4 and its orthologs in tobacco encode beta-cyano-L-alanine hydratase/nitrilase.
    J. Biol. Chem., 2001. 276(4): p. 2616-21
    [PMID:11060302]