PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_001193-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 366aa    MW: 40772.4 Da    PI: 7.2772
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_001193-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.21.6e-32203258156
        G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                    kpr++W+peLH+rF++a++qLGGs+ AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  NNU_001193-RA 203 KPRRCWSPELHRRFLHALQQLGGSHAATPKQIRELMKVDGLTNDEVKSHLQKYRLH 258
                    79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.047200260IPR017930Myb domain
SuperFamilySSF466891.23E-18201261IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.4E-29201261IPR009057Homeodomain-like
TIGRFAMsTIGR015575.3E-27203258IPR006447Myb domain, plants
PfamPF002491.4E-7205256IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MNPQPTMTIM ANYTENAHKC QTYMEALEEE RRKIQVFRRE LPLCLELVTQ AIETCRQQLA  60
TTTEYFPGQS ECSEETSSEA PVLEEFIPLK RCFSSEEDEE SNKPKNEDIN EKPGKKADWL  120
KSVQLWNQDP DPSLNQDLSR KPSVIESKKG GGAFHPFQRD DKLTAPSITV IPSSAQTTAA  180
ISSTADTING DNRGEDKSQS NRKPRRCWSP ELHRRFLHAL QQLGGSHAAT PKQIRELMKV  240
DGLTNDEVKS HLQKYRLHTR RPSPAVQNNG SPQPPQFVVV GGIWVPPHDY AAATETKGEL  300
NGVSGVTAHP TIYAPITAPS VPTVRSEQRQ KLSPRSPLQA EGRSSCKKDD DTHSNSPSTS  360
SSSRSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-13203256255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-13203256255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A3e-13203256154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-13203256154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-13203256154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-13203256154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-13203256255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-13203256255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-13203256255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-13203256255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-13203256255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-13203256255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in phosphate signaling in roots. {ECO:0000250|UniProtKB:Q9FX67}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00160DAPTransfer from AT1G25550Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010263063.10.0PREDICTED: myb family transcription factor EFM-like isoform X2
SwissprotQ9FPE81e-107HHO3_ARATH; Transcription factor HHO3
TrEMBLA0A1U8A8T70.0A0A1U8A8T7_NELNU; myb family transcription factor EFM-like isoform X2
STRINGXP_010263055.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.11e-105G2-like family protein
Publications ? help Back to Top
  1. Nagarajan VK,Satheesh V,Poling MD,Raghothama KG,Jain A
    Arabidopsis MYB-Related HHO2 Exerts a Regulatory Influence on a Subset of Root Traits and Genes Governing Phosphate Homeostasis.
    Plant Cell Physiol., 2016. 57(6): p. 1142-52
    [PMID:27016098]