PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_001168-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family TCP
Protein Properties Length: 429aa    MW: 48475 Da    PI: 7.4569
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_001168-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP143.41.7e-441462863131
            TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt.............ssssaseceaesssssasns 85 
                     kkdrhski T++g+RdRRvRls+++a++fFdLqd+LGfdk+skt+eWLl+++k+ai el++              + ss s+cea+s + +a+n 
  NNU_001168-RA 146 RKKDRHSKIFTSQGPRDRRVRLSLQIARKFFDLQDMLGFDKASKTVEWLLRKSKAAIRELAQGlpemkpsysgfskCVSSTSQCEAVSGVDEAANA 241
                    69*************************************************************999888888777766666677666666666633 PP

            TCP  86 ssgkaaksaakskksqksaasalnlakesrakarararertrekmr 131
                    +   + +  a +k+s k+++ ++ +a+esra+ar+rarertr+k  
  NNU_001168-RA 242 GD-WQGTMPAAKKSSVKDKNRFHPVARESRARARERARERTRKKIW 286
                    33.4555556788888888889*********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036349.8E-43146285IPR005333Transcription factor, TCP
PROSITE profilePS5136936.316147205IPR017887Transcription factor TCP subgroup
PROSITE profilePS5137010.936267284IPR017888CYC/TB1, R domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:2000032Biological Processregulation of secondary shoot formation
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 429 aa     Download sequence    Send to blast
MFPASFNSVT GNSVSFTDYA MLGEWRNLTG DFNSKQETTP SSFFNFPPFF IDCCNNIQDD  60
DNDGGMFFQR HYELPFCQLL PQQILSTKLS PNTIVADPVI AAAATHKYDN HNVNNKPIDD  120
VNASNTNNCA GRISPERQIL RKRSSRKKDR HSKIFTSQGP RDRRVRLSLQ IARKFFDLQD  180
MLGFDKASKT VEWLLRKSKA AIRELAQGLP EMKPSYSGFS KCVSSTSQCE AVSGVDEAAN  240
AGDWQGTMPA AKKSSVKDKN RFHPVARESR ARARERARER TRKKIWSRSL EESKRCPAEA  300
IPGEYGYDEW MGSHSHERRS SVNMVAAEVE GATSYSVEHQ ATTNDIVVEP FMAATNKSSP  360
CSIFNQHENA VSQGLFCDNS NNNDFPNFSE NWELDYLDRI HSTYCAMSNL QLSSEDVQER  420
IPISFCYLP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1271283RARERARERTRKK
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHQ5992820.0HQ599282.1 Nelumbo nucifera CYC-like protein 2 gene, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010262738.10.0PREDICTED: transcription factor TCP18-like
TrEMBLA0A1U8A6780.0A0A1U8A678_NELNU; transcription factor TCP18-like
STRINGXP_010262738.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G68800.12e-22TCP domain protein 12