PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_000838-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family G2-like
Protein Properties Length: 360aa    MW: 39566.6 Da    PI: 7.2516
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_000838-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like68.21.3e-212063144
        G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtle 44
                   kprl+WtpeLH+rFv av++LGG++kAtPk+++++m+v+gLtl+
  NNU_000838-RA 20 KPRLKWTPELHQRFVVAVTELGGADKATPKALMRVMDVPGLTLN 63
                   79****************************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.9E-191863IPR009057Homeodomain-like
SuperFamilySSF466895.73E-81962IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-132062IPR006447Myb domain, plants
PfamPF143795.7E-23119165IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 360 aa     Download sequence    Send to blast
MGMQKMQNQQ IGLILSTDAK PRLKWTPELH QRFVVAVTEL GGADKATPKA LMRVMDVPGL  60
TLNTGLGRAS SQNPTVTAGK KVRSLDLMEA DYGDKEVRGG YFSGELIGRT PTPINESLKI  120
AQALQMQMEV QKKLHEQIEV QRHLQLRIEA QGKYLQSVLK KAQETLAGYN SSSLGLEAAK  180
AELSQLASMV DNRCPSSSFS GLTEAGGFSL QEVGKQSMRG MDCSMDSSLT SSDSSGRKDE  240
NSQKLESGHP HDCNRHSNAA RLMEMYPNEG HLCKSDPSDR LHGQKRSWST ISDDISVDQP  300
TAKRSPTHKE KLGGQCTKLG LTDKLDLNSQ YQSEMESGCQ EFDLNSRVEE PIYVSKLFGA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010257629.10.0PREDICTED: myb family transcription factor PHL8-like isoform X1
TrEMBLA0A1U8A6X00.0A0A1U8A6X0_NELNU; myb family transcription factor PHL8-like isoform X1
STRINGXP_010257629.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69580.12e-65G2-like family protein