PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_000693-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family MYB_related
Protein Properties Length: 298aa    MW: 32304.1 Da    PI: 8.7446
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_000693-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.34e-1490134347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
    NNU_000693-RA  90 PWTEEEHRLFLVGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 134
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.647520IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129417.4883139IPR017930Myb domain
SuperFamilySSF466892.39E-1785140IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-1786137IPR006447Myb domain, plants
SMARTSM007172.2E-1087137IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.4E-1189134IPR009057Homeodomain-like
CDDcd001671.82E-990135No hitNo description
PfamPF002492.9E-1190134IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MSRSCSQCGN NGHNSRTCAE AGSGAASESG GFMLFGVRVT EGSIRKSVSM NNLSQYEQPQ  60
EPNADVNDGY ASDDVCHASA GNRERKRGVP WTEEEHRLFL VGLQKVGKGD WRGISRNFVK  120
TRTPTQVASH AQKYFLRRNN LNRRRRRSSL FDITTDTFMG LPMEEETVYQ ETTTQSPAPV  180
NCNIRFPVPA FPVTLSPVVL PGGGENPIEN LTLGKSEQTN APTKVVRPIP ILPIPPASRM  240
ADLNLNQKSS ADPSPLSLKL STPSSDQQAS PRHSAFQAMP SFGSGDLDSN GGSIITVA
Functional Description ? help Back to Top
Source Description
UniProtBinds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance. {ECO:0000269|PubMed:21030505}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by drought, high salinity, and ABA. {ECO:0000269|PubMed:21030505}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010255646.10.0PREDICTED: transcription factor MYB1R1-like
SwissprotQ2V9B02e-66MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLA0A1U8A3690.0A0A1U8A369_NELNU; transcription factor MYB1R1-like
STRINGXP_010255646.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.29e-71MYB_related family protein
Publications ? help Back to Top
  1. Shin D, et al.
    Expression of StMYB1R-1, a novel potato single MYB-like domain transcription factor, increases drought tolerance.
    Plant Physiol., 2011. 155(1): p. 421-32
    [PMID:21030505]