PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID NNU_000404-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; stem eudicotyledons; Proteales; Nelumbonaceae; Nelumbo
Family TCP
Protein Properties Length: 255aa    MW: 26423.7 Da    PI: 10.1439
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
NNU_000404-RAgenomeCASView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP122.16.3e-3831111283
            TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssas 83 
                    a+kk + +++h+kv+gR+RR+R+++ caar+F+L++eLG+++d++tieWLl+qa+p+i+++tgt++++as++ a+s s+ +s
  NNU_000404-RA  31 AVKKPPAKDRHSKVDGRGRRIRMPIICAARVFQLTRELGHKSDGQTIEWLLRQAEPSIIAATGTGTTPASFS-AVSVSVRGS 111
                    789******************************************************************777.222222222 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.9E-3337125IPR005333Transcription factor, TCP
PROSITE profilePS5136927.8923791IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MSTTDGATNG ATNGALMDPQ RQQPPGNGAL AVKKPPAKDR HSKVDGRGRR IRMPIICAAR  60
VFQLTRELGH KSDGQTIEWL LRQAEPSIIA ATGTGTTPAS FSAVSVSVRG SSGTSVSASL  120
DQKPTPPMLG PTPFILGKRL RTDDDADDGA KDDATAAAAA VAVGPTGGFW ALPARPDFGQ  180
VWSFAATPEM VVPTPAAVAV ASQQSMTGRF PQQPIGEASA ARVGNYLPIA QGHLNLLASL  240
SGAPASSVRR DDEHR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00524DAPTransfer from AT5G23280Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010249637.10.0PREDICTED: transcription factor TCP7
SwissprotQ9FMX22e-91TCP7_ARATH; Transcription factor TCP7
TrEMBLA0A1U7Z8A10.0A0A1U7Z8A1_NELNU; transcription factor TCP7
STRINGXP_010249637.10.0(Nelumbo nucifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23280.16e-54TCP family protein