PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf39126g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 248aa    MW: 29003.4 Da    PI: 4.8292
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf39126g00010.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1042e-3210104196
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                               lppGfrF P+deelv++yL +k++++++    ++ e+d++ +ePw+Lp+ +k +++ewyfFs rd+ky+tg r+nrat sgyWka
  Niben101Scf39126g00010.1  10 LPPGFRFCPSDEELVCHYLFNKITNEEIIK-GTLVEIDLHICEPWQLPEVAKLNSSEWYFFSFRDRKYTTGFRANRATISGYWKA 93 
                               79*************************766.78***************87788899***************************** PP

                       NAM  86 tgkdkevlskk 96 
                               tgkd+ v++  
  Niben101Scf39126g00010.1  94 TGKDRIVFDPC 104
                               *****999863 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.48E-388119IPR003441NAC domain
PROSITE profilePS5100531.46110155IPR003441NAC domain
PfamPF023653.5E-1611113IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MDLREIGATL PPGFRFCPSD EELVCHYLFN KITNEEIIKG TLVEIDLHIC EPWQLPEVAK  60
LNSSEWYFFS FRDRKYTTGF RANRATISGY WKATGKDRIV FDPCTHATED WVLCRVFHKA  120
KVENINNCRT RLSPQNTYEA AVTSPEFYNH SLNYDINNQN PPHQSQNSNI IHHHLFDLLV  180
KNHLQLSHQE MNDVSKDETT IHLSKYGQED DQYELMFDMD FEVPCLQEGV NSSLEDMKFD  240
DENSVVFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-281010015105Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019248936.11e-165PREDICTED: NAC domain-containing protein 21/22-like
TrEMBLA0A1J6J4231e-163A0A1J6J423_NICAT; Protein cup-shaped cotyledon 3
STRINGXP_009598091.11e-155(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.24e-62NAC domain containing protein 74