PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf19155g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family CO-like
Protein Properties Length: 336aa    MW: 37529.1 Da    PI: 6.3455
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf19155g00005.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.81.9e-071043336
                  zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg 36
                              +++C+ ++   ++ fC+ +  +lC +C +++H  
  Niben101Scf19155g00005.1 10 AKRCDSCKTTAATVFCKADMAFLCLSCDSKIHAA 43
                              579******99*********************54 PP

2zf-B_box24.65.2e-085395339
                  zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                               ++C+ +e+ +++  C+ +   lC +C + +H+       H++
  Niben101Scf19155g00005.1 53 VWVCEVCEHAPASVTCKADAAALCVTCDQDIHSAnplarrHER 95
                              689*****************************65777777876 PP

3CCT69.96.4e-24272315144
                       CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                               Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  Niben101Scf19155g00005.1 272 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 315
                               9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.111855IPR000315B-box-type zinc finger
SMARTSM003362.2E-11855IPR000315B-box-type zinc finger
PfamPF006432.7E-51050IPR000315B-box-type zinc finger
CDDcd000216.10E-71255No hitNo description
PROSITE profilePS5011910.7225198IPR000315B-box-type zinc finger
PfamPF006433.2E-65398IPR000315B-box-type zinc finger
CDDcd000217.23E-95498No hitNo description
SMARTSM003363.3E-115698IPR000315B-box-type zinc finger
PROSITE profilePS5101716.787272314IPR010402CCT domain
PfamPF062034.9E-18272314IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MVTESWSATA KRCDSCKTTA ATVFCKADMA FLCLSCDSKI HAANKLASRH ARVWVCEVCE  60
HAPASVTCKA DAAALCVTCD QDIHSANPLA RRHERFPIVP FYDSASAKSR GADEINPPHL  120
ETEEEAEAES WLLQTPNNNA QGIEYKSTEY LFSDVDPYVE MDMITVQKPC TDIQLHVPEY  180
KDDCVVPHVQ NKSEIHLQGP VVNGYPTYEM DFSGSKPFMY NFSSQSITQS VSSSSVEVGV  240
VPDHNTMADV SNTFVRNSST DGLPNPLSNL DREARVLRYR EKRKNRKFEK TIRYASRKAY  300
AETRPRIKGR FAKRTENEVD SLIASSDASY GVVPSF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009777143.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
RefseqXP_016509100.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T92e-97COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A1S4D6M30.0A0A1S4D6M3_TOBAC; zinc finger protein CONSTANS-LIKE 4-like
TrEMBLA0A1U7WEQ90.0A0A1U7WEQ9_NICSY; zinc finger protein CONSTANS-LIKE 4-like
STRINGXP_009777143.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-95CONSTANS-like 4