PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf17819g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 201aa    MW: 22100.3 Da    PI: 8.706
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf17819g00005.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26052.81.2e-164586142
                    DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnv 42
                              +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGa+nv
  Niben101Scf17819g00005.1 45 PCAACKLLRRRCAQECPFSPYFSPHEPQKFASVHKVFGATNV 86
                              7***************************************98 PP

2DUF26027.49.4e-098511966100
                    DUF260  66 earardPvyGavgvilklqqqleqlkaelallkee 100
                               ++r+rdPvyG++g i++lqq+++ l+ +l+++++e
  Niben101Scf17819g00005.1  85 NVRLRDPVYGCMGAISALQQEVQALQMQLNVVRAE 119
                               78****************************99987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089112.37544149IPR004883Lateral organ boundaries, LOB
PfamPF031956.9E-164587IPR004883Lateral organ boundaries, LOB
PfamPF031951.2E-685117IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MSRERERYEE IGKKIKREAD EYSQMGRRYL LGNPGTTITL NTVTPCAACK LLRRRCAQEC  60
PFSPYFSPHE PQKFASVHKV FGATNVRLRD PVYGCMGAIS ALQQEVQALQ MQLNVVRAEI  120
LKYKFGDTTT LTNIPSSHIS SLLAFGAVSV VATLPPPPPP PPPPPLSLPS TISSSDAMYA  180
QPSTTTEFST ISSENNISYF G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-294413710125LOB family transfactor Ramosa2.1
5ly0_B1e-294413710125LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019227654.11e-113PREDICTED: LOB domain-containing protein 15
SwissprotQ8L5T52e-59LBD15_ARATH; LOB domain-containing protein 15
TrEMBLA0A314KQ001e-112A0A314KQ00_NICAT; Lob domain-containing protein 15
STRINGXP_009591808.11e-100(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.11e-59LOB domain-containing protein 15
Publications ? help Back to Top
  1. Ohashi-Ito K,Iwamoto K,Fukuda H
    LOB DOMAIN-CONTAINING PROTEIN 15 Positively Regulates Expression of VND7, a Master Regulator of Tracheary Elements.
    Plant Cell Physiol., 2018. 59(5): p. 989-996
    [PMID:29444288]