PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf16530g00017.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 544aa    MW: 60717.2 Da    PI: 7.1642
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf16530g00017.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA49.46.2e-16741135
                      GATA  1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
                              C +Cg+t+TplWR+gp  ++ LCnaCG ++r kg+
  Niben101Scf16530g00017.1  7 CYHCGVTSTPLWRNGPPEKPILCNACGSRWRTKGT 41
                              ****************66666***********997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004013.0E-9155IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.23E-11446No hitNo description
CDDcd002022.62E-16655No hitNo description
Gene3DG3DSA:3.30.50.102.5E-12741IPR013088Zinc finger, NHR/GATA-type
PfamPF003201.0E-13741IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.2740IPR000679Zinc finger, GATA-type
PROSITE patternPS003440732IPR000679Zinc finger, GATA-type
PfamPF139196.1E-10281365IPR028020ASX homology domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MGKEGPCYHC GVTSTPLWRN GPPEKPILCN ACGSRWRTKG TLSNYTPLHA RAQSCDFEEH  60
RISRFKNMPM KNKEAKVLKR KQSHDMVEVG SPPDYNFGFR KCLDEDTSNR SSSGSVISNS  120
ESCAQFGSAE ASDLTGPAQS NIWDTTVPSK KRTCFNRPKP SSVEKLTKDL YTILHEQQQS  180
SCFSASSEDD LLFESEKPMV SVEIGHGSML IRHPSSICRE EESEASSLSV DNKHRSVNEA  240
YSRLTTRPVN ISKGVNSPNM GSDRTEKPIG QAVEQDQIKR NKEKLETLQI LGHHNSPLRY  300
IELKDLLNYE EFMMHLSSDE QQQLLKHLPP VDSFAPPDSL RSMFESSQFE ENVSSFQKLL  360
AEGVFDSSLP GVKLEDCRTL KRFILCYLSK SKWVEQYNLL KDTKCKNSSS GSEVAGEQSV  420
VGTCHSVNAK RPWEGPHLKY SGAKTTMKSP KSMVMKSIYE QKELLDNDGS CISPKSSFAL  480
PSETSSLVLD SFRSANENSD QDLLLNVPSN SYFPQAELLL PSSSFTPQAS TSSSSMYPSH  540
LVRP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009789570.10.0PREDICTED: GATA transcription factor 26-like
RefseqXP_016470951.10.0PREDICTED: GATA transcription factor 26-like
SwissprotQ8W4H11e-145GAT26_ARATH; GATA transcription factor 26
TrEMBLM1BTZ40.0M1BTZ4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000528000.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA20892462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17570.31e-147GATA transcription factor 26