PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf16469g01001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 338aa    MW: 38355.1 Da    PI: 6.7894
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf16469g01001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM180.25.2e-5651311129
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                               lppGfrFhPtdeel+++yL++k+++ ++++ ++i++vd++k+ePwdLp+k++ +ekewyfFs +d+ky+tg r+nrat++gyWk+
  Niben101Scf16469g01001.1   5 LPPGFRFHPTDEELISYYLTNKISDFNFTA-KAITDVDLNKCEPWDLPAKASMGEKEWYFFSLKDRKYPTGLRTNRATEAGYWKT 88 
                               79*************************999.88***************999999******************************* PP

                       NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                               tgkdke+++ +g l g+kktLvfy+grapkgekt+Wvmheyrle
  Niben101Scf16469g01001.1  89 TGKDKEIFR-GGVLAGMKKTLVFYRGRAPKGEKTNWVMHEYRLE 131
                               *********.********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.14E-643152IPR003441NAC domain
PROSITE profilePS5100559.6575151IPR003441NAC domain
PfamPF023652.2E-286130IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MEENLPPGFR FHPTDEELIS YYLTNKISDF NFTAKAITDV DLNKCEPWDL PAKASMGEKE  60
WYFFSLKDRK YPTGLRTNRA TEAGYWKTTG KDKEIFRGGV LAGMKKTLVF YRGRAPKGEK  120
TNWVMHEYRL ETKLGFKPSK EEWVVCRVFH KNSTAKKPQP TPSSPQSEES PNYDMTYTFA  180
NELGDIESPS NFYGLATPSI GHICNNISLQ NYSNENMMNM NLNMNLATAT TREASISNTL  240
PLLPAAWSSS LLCSNLPSVD SLLLRALQFR GYNNQPREVT ISTTNNYPFI ETQNISHIGI  300
DYNNPNLAVE APSSSMVPDP VQQQQPHEQS YKLGSNIW
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-56415716171NO APICAL MERISTEM PROTEIN
1ut4_B4e-56415716171NO APICAL MERISTEM PROTEIN
1ut7_A4e-56415716171NO APICAL MERISTEM PROTEIN
1ut7_B4e-56415716171NO APICAL MERISTEM PROTEIN
3swm_A4e-56415719174NAC domain-containing protein 19
3swm_B4e-56415719174NAC domain-containing protein 19
3swm_C4e-56415719174NAC domain-containing protein 19
3swm_D4e-56415719174NAC domain-containing protein 19
3swp_A4e-56415719174NAC domain-containing protein 19
3swp_B4e-56415719174NAC domain-containing protein 19
3swp_C4e-56415719174NAC domain-containing protein 19
3swp_D4e-56415719174NAC domain-containing protein 19
4dul_A4e-56415716171NAC domain-containing protein 19
4dul_B4e-56415716171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00364DAPTransfer from AT3G18400Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009763274.10.0PREDICTED: NAC domain-containing protein 77-like isoform X1
RefseqXP_016442160.10.0PREDICTED: NAC domain-containing protein 79-like isoform X1
TrEMBLA0A1S3XQM10.0A0A1S3XQM1_TOBAC; NAC domain-containing protein 79-like isoform X1
TrEMBLA0A1U7VLP90.0A0A1U7VLP9_NICSY; NAC domain-containing protein 77-like isoform X1
STRINGXP_009763274.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.11e-101NAC domain containing protein 58