PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf14311g01009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TCP
Protein Properties Length: 183aa    MW: 19461.1 Da    PI: 7.2145
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf14311g01009.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP90.83e-2831931173
                       TCP 11 ihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73
                               hTkv+g +RRvR++++ca r+F+L++eLG+ +d++tieWLl+  +pai+++tgt++ ++  +
  Niben101Scf14311g01009.1 31 KHTKVNGIGRRVRMPVLCAVRVFQLTKELGHRTDGETIEWLLRHEEPAIIAATGTGTVPSGYV 93
                              6******************************************************77776333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136920.5132682IPR017887Transcription factor TCP subgroup
PfamPF036345.5E-233193IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 183 aa     Download sequence    Send to blast
MGSDIVLHHN FTPHPTPSTG AVAVAGSGGA KHTKVNGIGR RVRMPVLCAV RVFQLTKELG  60
HRTDGETIEW LLRHEEPAII AATGTGTVPS GYVITTADSV PLSRSPPSVL APVNRSQPVS  120
GFPVSGGIFS MTSPPPSCRL DLYQPALEFS GNEYRHMPFT ALLLQPVTAD DGEKKVVGED  180
ENK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009794398.11e-112PREDICTED: transcription factor TCP11
SwissprotQ9SJK72e-32TCP11_ARATH; Transcription factor TCP11
TrEMBLA0A1U7XTX01e-111A0A1U7XTX0_NICSY; transcription factor TCP11
STRINGXP_009794398.11e-111(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24824201
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37000.12e-34TCP family protein