PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf14206g00007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 96aa    MW: 10826.2 Da    PI: 4.4202
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf14206g00007.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26044.16.1e-141396199
                    DUF260 61 lvyeAearardPvyGavgvilklqqqleqlkaelallke 99
                              +vyeA+ar+rdPvyG++g i++lq+q+++l+a+la+++ 
  Niben101Scf14206g00007.1  1 MVYEANARIRDPVYGCAGAIWQLQKQISELQAQLAKAQV 39
                              69*********************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.58141IPR004883Lateral organ boundaries, LOB
PfamPF031959.7E-12138IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MVYEANARIR DPVYGCAGAI WQLQKQISEL QAQLAKAQVE MLNVQSQNAN LVALICKEMS  60
QNQVNKDKND AQFYGNTSLF LEDNSVYAAW EPLWTG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009776231.13e-56PREDICTED: LOB domain-containing protein 1-like
RefseqXP_016480967.13e-56PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR07e-30LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A1S4AWG47e-55A0A1S4AWG4_TOBAC; LOB domain-containing protein 1-like
TrEMBLA0A1U7WG437e-55A0A1U7WG43_NICSY; LOB domain-containing protein 1-like
STRINGXP_009776231.11e-55(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA2008933
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.13e-32LOB domain-containing protein 1