PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf14206g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 190aa    MW: 20838.9 Da    PI: 5.2508
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf14206g00005.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.53.9e-4233131199
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l+++ e+er da++s+vyeA+ar+rdPvyG++g i +lq+
  Niben101Scf14206g00005.1  33 PCAACKILRRRCVDKCVLAPYFPPTEPLKFTIAHRVFGASNIIKMLQEVGEDERADAVKSMVYEANARIRDPVYGCAGAICQLQK 117
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaelallke 99 
                               q+++l+aela+++ 
  Niben101Scf14206g00005.1 118 QISELQAELAKAQV 131
                               **********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.57732133IPR004883Lateral organ boundaries, LOB
PfamPF031951.5E-4233130IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MECSDKITAT SSSSSAGMMT PPLSPPSPVI LTPCAACKIL RRRCVDKCVL APYFPPTEPL  60
KFTIAHRVFG ASNIIKMLQE VGEDERADAV KSMVYEANAR IRDPVYGCAG AICQLQKQIS  120
ELQAELAKAQ VEMLNVQSQN ANLVSLICRE MSQNQENNGS VCPHQQTNYG NTNLFLDDNS  180
VYPALEPLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-41241352113LOB family transfactor Ramosa2.1
5ly0_B1e-41241352113LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016485630.11e-118PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR04e-68LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A1S4B9N01e-116A0A1S4B9N0_TOBAC; LOB domain-containing protein 1-like
STRINGXP_009588230.11e-116(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.15e-70LOB domain-containing protein 1