PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf13231g00006.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 326aa    MW: 36434.5 Da    PI: 8.8092
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf13231g00006.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA97.91e-30168224158
                 CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                               +ep+Y NaKQy++Il+RRq Rak+e ekk  +k+rkpylheSRh+hA+rR+Rg+gGrF
  Niben101Scf13231g00006.1 168 EEPVYMNAKQYHGILRRRQIRAKAELEKKA-IKARKPYLHESRHQHAMRRARGTGGRF 224
                               69***************************9.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.3E-35166227IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115237.178167227IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.1E-26169224IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.9E-24170192IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.9E-24201224IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MPTIAKHDGR QLQTALRMTS QPTIHMQSWW QGYGDNTMPL ASENTVAQGN AEGGNEEKET  60
NAQATESGSK GNNMQYKQHL QHITSTTAAI MGEQQKELTG HSAMVTSYPY PDLQYGGMMT  120
YGAPVHPHLF EIHHARMALP LDMEEEPVHP HLFEIHHARM ALPLDMEEEP VYMNAKQYHG  180
ILRRRQIRAK AELEKKAIKA RKPYLHESRH QHAMRRARGT GGRFLNTKKL NDMDCTTEEP  240
KKYGATIPTH SGNSSGSGSS DQREKEGSTV EDMHKGRSRS FSTSNGHGSS VYFSENTGNE  300
QRNGYYGRGS WSLLVSQASR GAASNN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-19168228262NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016443427.10.0PREDICTED: nuclear transcription factor Y subunit A-1-like isoform X1
TrEMBLA0A1S3XUQ60.0A0A1S3XUQ6_TOBAC; nuclear transcription factor Y subunit A-1-like isoform X1
STRINGXP_009626580.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA112322025
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G12840.48e-27nuclear factor Y, subunit A1