PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf13168g00007.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 363aa    MW: 41254 Da    PI: 7.116
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                               XCHHHCHHHHHHHHHHHHHHHHHHHHHHHH CS
                    bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLee 33 
                                k++rr+++NReAAr+sR RKka++++Le+
  Niben101Scf13168g00007.1  80 EKVQRRLAQNREAARKSRMRKKAYVQQLET 109
                               699*************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA: hitNo description
SMARTSM003386.3E-677137IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.11779123IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.19E-781116No hitNo description
PfamPF001703.7E-781111IPR004827Basic-leucine zipper domain
PROSITE patternPS0003608499IPR004827Basic-leucine zipper domain
PfamPF141443.2E-28167240IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009776929.10.0PREDICTED: transcription factor TGA1-like
RefseqXP_009776936.10.0PREDICTED: transcription factor TGA1-like
RefseqXP_016467889.10.0PREDICTED: transcription factor TGA1-like
RefseqXP_016467890.10.0PREDICTED: transcription factor TGA1-like
SwissprotQ392371e-154TGA1_ARATH; Transcription factor TGA1
TrEMBLA0A1S3ZU800.0A0A1S3ZU80_TOBAC; transcription factor TGA1-like
TrEMBLA0A1U7WI510.0A0A1U7WI51_NICSY; transcription factor TGA1-like
STRINGXP_009776929.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65210.51e-142bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
  3. Herrera-Vásquez A, et al.
    Transcriptional Control of Glutaredoxin GRXC9 Expression by a Salicylic Acid-Dependent and NPR1-Independent Pathway in Arabidopsis.
    Plant Mol. Biol. Rep., 2018.
  4. Gutsche N,Zachgo S
    The N-Terminus of the Floral Arabidopsis TGA Transcription Factor PERIANTHIA Mediates Redox-Sensitive DNA-Binding.
    PLoS ONE, 2016. 11(4): p. e0153810
  5. Sun T, et al.
    TGACG-BINDING FACTOR 1 (TGA1) and TGA4 regulate salicylic acid and pipecolic acid biosynthesis by modulating the expression of SYSTEMIC ACQUIRED RESISTANCE DEFICIENT 1 (SARD1) and CALMODULIN-BINDING PROTEIN 60g (CBP60g).
    New Phytol., 2018. 217(1): p. 344-354