PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf12959g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Trihelix
Protein Properties Length: 272aa    MW: 31755.1 Da    PI: 7.2563
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf12959g00003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix78.69.4e-2544126186
                  trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdql 85 
                               +W+ qe+++ + +r e+++++ ++k++k lWe ++ km+++g++rsp+qCk+kw+nl +ryk +++ e +     ++++p++++l
  Niben101Scf12959g00003.1  44 QWSIQETRDFLMIRAELDQTFMETKRNKLLWEVIATKMKDKGYNRSPEQCKCKWKNLVTRYKGCETLEPEA--L-RQQFPFYNEL 125
                               7********************************************************************95..3.4589*****9 PP

                  trihelix  86 e 86 
                               +
  Niben101Scf12959g00003.1 126 Q 126
                               8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122034.31E-2543108No hitNo description
PfamPF138374.2E-2044128No hitNo description
PROSITE profilePS500907.44545101IPR017877Myb-like domain
Sequence ? help Back to Top
Protein Sequence    Length: 272 aa     Download sequence    Send to blast
MDPHLHHHHH QQQQQNPFSH QSVNVDTSGV GVNIGTTSGD RFPQWSIQET RDFLMIRAEL  60
DQTFMETKRN KLLWEVIATK MKDKGYNRSP EQCKCKWKNL VTRYKGCETL EPEALRQQFP  120
FYNELQAIFA ARMQRMLWME AEGGGGSKKK TISQLSSDED EENEDSEGEK IVGITKKKRK  180
VKGNNVNIVG SSSSGGSGNL LVNSFKEILH DFMKQQMAME MQWLKAYEAK EEERRIKEME  240
WRQTMEALEN ESLKEDKMKL FDQRFVLNLL FL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A5e-1341124386DNA binding protein GT-1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1175180KKKRKV
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specifically to the core DNA sequence 5'-GTTAC-3'. {ECO:0000269|PubMed:15044016}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019250357.11e-151PREDICTED: trihelix transcription factor GT-3b-like
SwissprotQ9SDW09e-66TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A1J6I7M61e-149A0A1J6I7M6_NICAT; Trihelix transcription factor gt-3b
STRINGXP_009799172.11e-149(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41872343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.13e-56Trihelix family protein