PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf12394g02003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 169aa    MW: 19288.9 Da    PI: 5.3128
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf12394g02003.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM55.91.5e-17551148
                       NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                              lppGfrFhPtdeel+++yL++k+++ ++++ ++i++vd++k+ePwdLp
  Niben101Scf12394g02003.1  5 LPPGFRFHPTDEELITFYLTNKISDFNFTA-KAIADVDLNKCEPWDLP 51
                              79*************************999.88**************9 PP

2NAM50.76e-16539380121
                       NAM  80 sgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdW 121
                               +gyWk+tg+dke+++ +g lvg+kktLvfy+grapkgekt+W
  Niben101Scf12394g02003.1  53 AGYWKTTGNDKEIFR-GGVLVGMKKTLVFYRGRAPKGEKTNW 93 
                               7**************.************************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100516.0321131IPR003441NAC domain
SuperFamilySSF1019412.48E-393104IPR003441NAC domain
PfamPF023655.8E-16693IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MEENLPPGFR FHPTDEELIT FYLTNKISDF NFTAKAIADV DLNKCEPWDL PEAGYWKTTG  60
NDKEIFRGGV LVGMKKTLVF YRGRAPKGEK TNWEEWVVCR VFHKSSTVKK PQPTSSSPQS  120
EESPNCDMTY TFANELGDIE LPSNFYGLAT PSMAIFAIIF LYRITPLRT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-29411016171NO APICAL MERISTEM PROTEIN
1ut4_B1e-29411016171NO APICAL MERISTEM PROTEIN
1ut7_A1e-29411016171NO APICAL MERISTEM PROTEIN
1ut7_B1e-29411016171NO APICAL MERISTEM PROTEIN
3swm_A1e-29411019174NAC domain-containing protein 19
3swm_B1e-29411019174NAC domain-containing protein 19
3swm_C1e-29411019174NAC domain-containing protein 19
3swm_D1e-29411019174NAC domain-containing protein 19
3swp_A1e-29411019174NAC domain-containing protein 19
3swp_B1e-29411019174NAC domain-containing protein 19
3swp_C1e-29411019174NAC domain-containing protein 19
3swp_D1e-29411019174NAC domain-containing protein 19
4dul_A1e-29411016171NAC domain-containing protein 19
4dul_B1e-29411016171NAC domain-containing protein 19
Search in ModeBase
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed post-transcriptionally by miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808, ECO:0000269|PubMed:18305205, ECO:0000305|PubMed:15723790}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009763274.13e-89PREDICTED: NAC domain-containing protein 77-like isoform X1
RefseqXP_016442160.13e-89PREDICTED: NAC domain-containing protein 79-like isoform X1
SwissprotQ9FLR32e-46NAC79_ARATH; NAC domain-containing protein 79
TrEMBLA0A1S3XQM17e-88A0A1S3XQM1_TOBAC; NAC domain-containing protein 79-like isoform X1
TrEMBLA0A1U7VLP97e-88A0A1U7VLP9_NICSY; NAC domain-containing protein 77-like isoform X1
STRINGXP_009763274.11e-88(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1801044
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.12e-57NAC domain containing protein 58
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Vidal EA,Álvarez JM,Gutiérrez RA
    Nitrate regulation of AFB3 and NAC4 gene expression in Arabidopsis roots depends on NRT1.1 nitrate transport function.
    Plant Signal Behav, 2014. 9(3): p. e28501
    [PMID:24642706]
  4. Lee MH,Jeon HS,Kim HG,Park OK
    An Arabidopsis NAC transcription factor NAC4 promotes pathogen-induced cell death under negative regulation by microRNA164.
    New Phytol., 2017. 214(1): p. 343-360
    [PMID:28032643]