PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf12314g00005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 324aa    MW: 36921 Da    PI: 8.6568
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf12314g00005.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.51.8e-55171431129
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                               lppGfrFhPtdeel+++yL +kv ++++ +  +i evd++k+ePwdLp k+k +ekewyfF+ rdkky+tg r+nrat++gyWka
  Niben101Scf12314g00005.1  17 LPPGFRFHPTDEELITHYLSNKVVDSNFFA-IAIGEVDLNKIEPWDLPWKAKMGEKEWYFFCVRDKKYPTGLRTNRATAAGYWKA 100
                               79*************************877.78***************888999******************************* PP

                       NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                               tgkd+e+++ +++lvg+kktLvfykgrapkgekt+Wv+heyrle
  Niben101Scf12314g00005.1 101 TGKDREIFR-GKSLVGMKKTLVFYKGRAPKGEKTNWVIHEYRLE 143
                               *********.999*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.09E-5813148IPR003441NAC domain
PROSITE profilePS5100553.03117164IPR003441NAC domain
PfamPF023651.8E-2818142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MENYLGLVKE DDQQMELPPG FRFHPTDEEL ITHYLSNKVV DSNFFAIAIG EVDLNKIEPW  60
DLPWKAKMGE KEWYFFCVRD KKYPTGLRTN RATAAGYWKA TGKDREIFRG KSLVGMKKTL  120
VFYKGRAPKG EKTNWVIHEY RLEGRLSLQN LPKSAKIVSS KSAQISKGLV KLNSDENEMA  180
NSNCLPPLTD SSPYTSKIKP SASQSSHVHC FSNIFTAQKS QENMMNCFNN SPNFSALSNL  240
MNNQIFPVQS SFPSQVSFGM QNPTILKTLL ENYTQKFKKE DIVSLSQETK LSTDMNNEIS  300
SIASNLEMGR RLLEDQSLDC LWSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-5151421140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtBinds to the promoter regions of genes involved in chlorophyll catabolic processes, such as NYC1, SGR1, SGR2 and PAO. {ECO:0000269|PubMed:27021284}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by the microRNA miR164. {ECO:0000269|PubMed:15294871, ECO:0000269|PubMed:17098808}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009802067.10.0PREDICTED: NAC domain-containing protein 100 isoform X1
RefseqXP_009802134.10.0PREDICTED: NAC domain-containing protein 100 isoform X1
RefseqXP_016439814.10.0PREDICTED: NAC domain-containing protein 100-like isoform X1
RefseqXP_016439815.10.0PREDICTED: NAC domain-containing protein 100-like isoform X1
SwissprotQ9FLJ21e-114NC100_ARATH; NAC domain-containing protein 100
TrEMBLA0A1S3XIL90.0A0A1S3XIL9_TOBAC; NAC domain-containing protein 100-like isoform X1
TrEMBLA0A1U7YD760.0A0A1U7YD76_NICSY; NAC domain-containing protein 100 isoform X1
STRINGXP_009802067.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA15224279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61430.11e-116NAC domain containing protein 100
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]