PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf11836g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 209aa    MW: 23235.5 Da    PI: 8.6648
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf11836g00008.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26037.75.8e-12248142
                    DUF260  1 aCaaCkvlrrkCakdCvlapyf.....paeqpkkfanvhklFGasnv 42
                              +C++C+vlr++C+++C+l+p++     p++q +++ +v+k+FG++ +
  Niben101Scf11836g00008.1  2 SCNGCRVLRKGCSENCILRPCLqwietPDAQGHATIFVAKFFGRAGL 48
                              6*************************9****************9876 PP

2DUF26033.41.3e-1047885697
                    DUF260 56 damsslvyeAearardPvyGavgvilklqqqleqlkaelall 97
                               +++sl+yeA  r+ +Pv+G+vg++++++++++q+++e++l+
  Niben101Scf11836g00008.1 47 GLFQSLLYEAAGRTVNPVNGVVGLLWTGNWHVCQAAVETVLR 88
                              689*********************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508919.693192IPR004883Lateral organ boundaries, LOB
PfamPF031952.9E-14286IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MSCNGCRVLR KGCSENCILR PCLQWIETPD AQGHATIFVA KFFGRAGLFQ SLLYEAAGRT  60
VNPVNGVVGL LWTGNWHVCQ AAVETVLRGG TLSPIPELFG KSSEVDDESK CKNVFKLLNH  120
TQNTRSRMQK RHCSSDDQAA AKVLQLENID PSLLTRGFQS EIVYSPLPEK RRPRTPSRKS  180
EESVITTCFE SSSLGDHQGK QPRLLNLFT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019225598.11e-134PREDICTED: LOB domain-containing protein 37-like isoform X1
SwissprotQ9SN232e-63LBD38_ARATH; LOB domain-containing protein 38
TrEMBLA0A314KT941e-133A0A314KT94_NICAT; Lob domain-containing protein 37
STRINGXP_009630227.11e-128(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9662490
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49940.17e-66LOB domain-containing protein 38