PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf11670g03002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 305aa    MW: 35299 Da    PI: 6.4452
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf11670g03002.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.21.3e-52151431128
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgy 82 
                               +ppGfrFhPt+eel+++yLkkkv+ +k++l +vi+evd++++ePwd+++k+k     +++wyfFs++dkky+tg+r+nrat++g+
  Niben101Scf11670g03002.1  15 VPPGFRFHPTEEELLQYYLKKKVAIEKIDL-DVIQEVDLNNLEPWDIQEKCKIgstPQNDWYFFSHKDKKYPTGSRTNRATAAGF 98 
                               69****************************.9***************964444222455************************** PP

                       NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               Wkatg+dk ++s +++ +g++ktLvfykgrap+g+k+dW+mheyrl
  Niben101Scf11670g03002.1  99 WKATGRDKVIYS-NSRRIGMRKTLVFYKGRAPHGQKSDWIMHEYRL 143
                               ************.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-549148IPR003441NAC domain
PROSITE profilePS5100551.73515176IPR003441NAC domain
PfamPF023656.5E-2816143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MPDNMSISVN GQSQVPPGFR FHPTEEELLQ YYLKKKVAIE KIDLDVIQEV DLNNLEPWDI  60
QEKCKIGSTP QNDWYFFSHK DKKYPTGSRT NRATAAGFWK ATGRDKVIYS NSRRIGMRKT  120
LVFYKGRAPH GQKSDWIMHE YRLDDHSCNI KKNHFKSLEM VNPSISDTRI NQIIYPNDEG  180
ALEQLLQYMR NTCKEENHSN YDLNFNDKFM QLPTLDSPNS SYDDFPKSIN SEGGLNNWIA  240
VDRLVASHLN GQTSDNYNHD YEHQYNSNGG GGSTNHDYNE ECDLWSFSRV STNDHSLCHV  300
SNRPV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-4791439140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator of genes involved in biosynthesis of secondary walls. Together with NST2 and NST3, required for the secondary cell wall thickening of sclerenchymatous fibers, secondary xylem (tracheary elements), and of the anther endocethium, which is necessary for anther dehiscence. May also regulate the secondary cell wall lignification of other tissues. {ECO:0000269|PubMed:16214898, ECO:0000269|PubMed:17237351, ECO:0000269|PubMed:17333250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009791966.10.0PREDICTED: NAC domain-containing protein 43-like
RefseqXP_016450002.10.0PREDICTED: NAC domain-containing protein 43-like
SwissprotQ84WP61e-105NAC43_ARATH; NAC domain-containing protein 43
TrEMBLA0A1S3YDD00.0A0A1S3YDD0_TOBAC; NAC domain-containing protein 43-like
TrEMBLA0A1U7XQR70.0A0A1U7XQR7_NICSY; NAC domain-containing protein 43-like
STRINGXP_009791966.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-107NAC family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Gondolf VM, et al.
    A gene stacking approach leads to engineered plants with highly increased galactan levels in Arabidopsis.
    BMC Plant Biol., 2014. 14: p. 344
    [PMID:25492673]
  3. Jaradat MR,Ruegger M,Bowling A,Butler H,Cutler AJ
    A comprehensive transcriptome analysis of silique development and dehiscence in Arabidopsis and Brassica integrating genotypic, interspecies and developmental comparisons.
    GM Crops Food, 2014. 5(4): p. 302-20
    [PMID:25523176]
  4. Yuan Y,Teng Q,Zhong R,Ye ZH
    TBL3 and TBL31, Two Arabidopsis DUF231 Domain Proteins, are Required for 3-O-Monoacetylation of Xylan.
    Plant Cell Physiol., 2016. 57(1): p. 35-45
    [PMID:26556650]
  5. Yang C, et al.
    Transcription Factor MYB26 Is Key to Spatial Specificity in Anther Secondary Thickening Formation.
    Plant Physiol., 2017. 175(1): p. 333-350
    [PMID:28724622]
  6. Pascual MB, et al.
    PpNAC1, a main regulator of phenylalanine biosynthesis and utilization in maritime pine.
    Plant Biotechnol. J., 2018. 16(5): p. 1094-1104
    [PMID:29055073]
  7. Liu C,Yu H,Li L
    SUMO modification of LBD30 by SIZ1 regulates secondary cell wall formation in Arabidopsis thaliana.
    PLoS Genet., 2019. 15(1): p. e1007928
    [PMID:30657769]