PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf10559g01036.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 119aa    MW: 13589.2 Da    PI: 5.825
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf10559g01036.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26024.67.1e-088584595
                    DUF260 45 llkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95
                              +  +lpe++r da+ss+vy+A++r+rd   +   +i+k ++ql++l +e a
  Niben101Scf10559g01036.1  8 VEVELPEHQRGDAVSSMVYKANVRVRDHLCNNDLIISKHNWQLHKLTHENA 58
                              556899***************************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031956.2E-61058IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 119 aa     Download sequence    Send to blast
MQLAISQVEV ELPEHQRGDA VSSMVYKANV RVRDHLCNND LIISKHNWQL HKLTHENATI  60
FFDWHGQKLA GKCVAVVLTY SNSTNYISFT MDMVVDQANM GEFLRTSLAD PSRDDDDHN
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.11e-08LOB domain-containing protein 4