PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf10466g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 386aa    MW: 43889.2 Da    PI: 5.583
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf10466g00016.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM167.64e-52131401128
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyW 83 
                               l+pGfrFhPtdeelv +yL++k+ +k++++ ++++e+d+yk+ePw+L +  ++k+++ ewyfFs+ d+ky +g+r nrat++gyW
  Niben101Scf10466g00016.1  13 LAPGFRFHPTDEELVRYYLRRKACAKPFRF-QAVSEIDVYKSEPWELAEysSLKTRDLEWYFFSPVDRKYGNGSRLNRATDKGYW 96 
                               579*************************99.88**************84346777888*************************** PP

                       NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               katgkd++v + k++++g+kktLvf++grap+g++t+Wvmheyrl
  Niben101Scf10466g00016.1  97 KATGKDRPVRH-KSQTIGMKKTLVFHSGRAPDGKRTNWVMHEYRL 140
                               ***********.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-626163IPR003441NAC domain
PROSITE profilePS510055813163IPR003441NAC domain
PfamPF023653.0E-2815140IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 386 aa     Download sequence    Send to blast
MPKRAVAPPP TSLAPGFRFH PTDEELVRYY LRRKACAKPF RFQAVSEIDV YKSEPWELAE  60
YSSLKTRDLE WYFFSPVDRK YGNGSRLNRA TDKGYWKATG KDRPVRHKSQ TIGMKKTLVF  120
HSGRAPDGKR TNWVMHEYRL TDEELERAGV VQDAFVLCRI FQKSGLGPPN GDRYAPFIEE  180
EWDDDTALLV PGGETEDDVA NGDEARVEGN DLDQDARHKA PPRQSQNLLE PQPIPFVCKR  240
ERSPEDPEPL SLAQSKRSKR EDPSSSHANG SEDSTTSQQD PPTTMMTTNY SPPSLLAFPL  300
LEPLEPKESQ PSNPPTFDSS NLEKSVPPGY LKFISNLENE ILNVSMERET LKIEVMRAQA  360
MINILQSRID LLNKENEDLR RLVRGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A5e-501216316165NO APICAL MERISTEM PROTEIN
1ut4_B5e-501216316165NO APICAL MERISTEM PROTEIN
1ut7_A5e-501216316165NO APICAL MERISTEM PROTEIN
1ut7_B5e-501216316165NO APICAL MERISTEM PROTEIN
3swm_A4e-501216319168NAC domain-containing protein 19
3swm_B4e-501216319168NAC domain-containing protein 19
3swm_C4e-501216319168NAC domain-containing protein 19
3swm_D4e-501216319168NAC domain-containing protein 19
3swp_A4e-501216319168NAC domain-containing protein 19
3swp_B4e-501216319168NAC domain-containing protein 19
3swp_C4e-501216319168NAC domain-containing protein 19
3swp_D4e-501216319168NAC domain-containing protein 19
4dul_A5e-501216316165NAC domain-containing protein 19
4dul_B5e-501216316165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC051/NAC052 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). {ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009780872.10.0PREDICTED: NAC domain-containing protein 78-like
RefseqXP_016454404.10.0PREDICTED: NAC domain-containing protein 78-like
SwissprotQ9SQX91e-112NAC50_ARATH; NAC domain containing protein 50
TrEMBLA0A1S3YQB70.0A0A1S3YQB7_TOBAC; NAC domain-containing protein 78-like
TrEMBLA0A1U7WLM80.0A0A1U7WLM8_NICSY; NAC domain-containing protein 78-like
STRINGXP_009780872.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA31402448
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10480.21e-110NAC domain containing protein 50
Publications ? help Back to Top
  1. Zhang S, et al.
    C-terminal domains of a histone demethylase interact with a pair of transcription factors and mediate specific chromatin association.
    Cell Discov, 2019.
    [PMID:26617990]