PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf10191g01007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NF-YA
Protein Properties Length: 348aa    MW: 38126.6 Da    PI: 9.4405
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf10191g01007.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA101.11.1e-31207261358
                 CBFB_NFYA   3 plYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                               p+YVNaKQy++IlkRRq Rakle ++kl  k rkpylheSRh+hA++R+Rg+gGrF
  Niben101Scf10191g01007.1 207 PIYVNAKQYSAILKRRQVRAKLEVQNKL-VKDRKPYLHESRHRHAMKRARGTGGRF 261
                               9***************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005212.9E-36203264IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115235.821204264IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.0E-27207261IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006169.4E-24207229IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860209229IPR018362CCAAT-binding factor, conserved site
PRINTSPR006169.4E-24238261IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 348 aa     Download sequence    Send to blast
MDSSLSSHSL AKAKDSGARD SKRMISFSQK DVRGKEGQSF TPLFVNCSSM WSSDEQPESA  60
PSKSVLTGAE SASKCHSNIK QSESQYQDQD STSTLSTGQS DHVETVMAKS NTVLQNVALH  120
PGWDGIYEVQ GESGTKASLS GKSATNTLPQ PLVHINHPMA CASYPWADTY FGRLMATYGS  180
NAIIYPQMVG VTSTRVALPL ECTESLPIYV NAKQYSAILK RRQVRAKLEV QNKLVKDRKP  240
YLHESRHRHA MKRARGTGGR FLNTKNMQQS KPSSPTHDKS IFKGTAGGNL TRSIVQHSES  300
GSWGTSTQSG SDVTSIFSGD DMFQQPEFRV SSFPFHMQEA ADFMHVGT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-20207275472NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1245254RHRHAMKRAR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009769785.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like
RefseqXP_009769786.10.0PREDICTED: nuclear transcription factor Y subunit A-3-like
TrEMBLA0A1U7W6920.0A0A1U7W692_NICSY; nuclear transcription factor Y subunit A-3-like
STRINGXP_009769785.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA48002027
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.14e-44nuclear factor Y, subunit A3