PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf09658g00029.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 148aa    MW: 17618 Da    PI: 9.4899
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf09658g00029.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.11.2e-5561331128
                       NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyW 83 
                               lppGfrFhPtdeelv++yLk+k++g+++el ++i+evd+yk+ePw+L  k  + +++ ewyfF +rd+ky++g r+nrat++gyW
  Niben101Scf09658g00029.1   6 LPPGFRFHPTDEELVNYYLKRKIHGQEIEL-DIIPEVDLYKCEPWELAeKsFLPSRDPEWYFFGPRDRKYPNGFRTNRATRAGYW 89 
                               79****************************.99**************84335556888*************************** PP

                       NAM  84 katgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                               k+tgkd++v s +++++g+kktLv+y+grap+g +tdWvmheyrl
  Niben101Scf09658g00029.1  90 KSTGKDRRVSS-QNRAIGMKKTLVYYRGRAPQGIRTDWVMHEYRL 133
                               **********9.8999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.79E-604142IPR003441NAC domain
PROSITE profilePS5100555.7866148IPR003441NAC domain
PfamPF023655.7E-317133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 148 aa     Download sequence    Send to blast
MAPVGLPPGF RFHPTDEELV NYYLKRKIHG QEIELDIIPE VDLYKCEPWE LAEKSFLPSR  60
DPEWYFFGPR DRKYPNGFRT NRATRAGYWK STGKDRRVSS QNRAIGMKKT LVYYRGRAPQ  120
GIRTDWVMHE YRLDDKECDE ISSIQNRK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-55213311140Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009621552.11e-106PREDICTED: NAC domain-containing protein 86 isoform X2
RefseqXP_009790485.11e-106PREDICTED: NAC domain-containing protein 74 isoform X2
RefseqXP_016441522.11e-106PREDICTED: NAC domain-containing protein 86-like isoform X2
RefseqXP_016510515.11e-106PREDICTED: NAC domain-containing protein 86-like isoform X2
SwissprotQ9FFI54e-81NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A1S3XPE11e-105A0A1S3XPE1_TOBAC; NAC domain-containing protein 86-like isoform X2
TrEMBLA0A1S4DAP21e-105A0A1S4DAP2_TOBAC; NAC domain-containing protein 86-like isoform X2
TrEMBLA0A1U7XVJ61e-105A0A1U7XVJ6_NICSY; NAC domain-containing protein 74 isoform X2
STRINGXP_009790484.11e-105(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46212442
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G17730.11e-103NAC domain containing protein 57
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]