PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf09644g00016.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Whirly
Protein Properties Length: 306aa    MW: 34007.2 Da    PI: 9.4748
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf09644g00016.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly102.15.1e-32165238174
                    Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesc 74 
                               s+yk+kaal+v+++ p+f+ ldsg++kl+r+G++ll++a+a+++r+ydW++kq+f+ls+te+++l+++++k+sc
  Niben101Scf09644g00016.1 165 SIYKGKAALTVDPRPPEFSPLDSGAFKLSREGFVLLQFAPAAGVRQYDWGRKQVFSLSVTEMGSLISFGAKDSC 238
                               7************************************************************************9 PP

2Whirly20.48.7e-07239267111139
                    Whirly 111 vtnslvkgnesfsvPvskaefavlrsllv 139
                               v+n+l++ +e++++Pv+kaefavl+s+++
  Niben101Scf09644g00016.1 239 VQNKLINLDENIYIPVTKAEFAVLISAFN 267
                               89************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.105.6E-37152238IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544474.32E-59158306IPR009044ssDNA-binding transcriptional regulator
PfamPF085362.2E-29166239IPR013742Plant transcription factor
Gene3DG3DSA:2.30.31.108.6E-15239289IPR009044ssDNA-binding transcriptional regulator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MLNLSLSPAG FSLNLQNPTK SSSPYPHHQS LSFSSSFNNI NPLNSNTKCP KAFPRNLSLT  60
CRHSEYFEPQ QQQQQQAMLN LSLSPAGFSL NLQNPTKSSS PYPHHQSLSF SSSFNNINPL  120
NSNTKCPKAF PRNLSLTCRH SEYFEPQQQQ QQQGASTPKV YVGYSIYKGK AALTVDPRPP  180
EFSPLDSGAF KLSREGFVLL QFAPAAGVRQ YDWGRKQVFS LSVTEMGSLI SFGAKDSCVQ  240
NKLINLDENI YIPVTKAEFA VLISAFNFVV PYLLGWHTAV NSFKPEDASR SNNANPRSGA  300
DLEWSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1l3a_A6e-9413930412218p24: plant transcriptional regulator PBF-2
1l3a_B6e-9413930412218p24: plant transcriptional regulator PBF-2
1l3a_C6e-9413930412218p24: plant transcriptional regulator PBF-2
1l3a_D6e-9413930412218p24: plant transcriptional regulator PBF-2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016474450.11e-147PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like
SwissprotQ9LL851e-116WHY1_SOLTU; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLA0A0V0HSY51e-114A0A0V0HSY5_SOLCH; Putative single-stranded DNA-binding protein WHY1, chloroplastic-like
STRINGPGSC0003DMT4000454391e-114(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA77312430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14410.13e-76ssDNA-binding transcriptional regulator