PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf09414g00008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LFY
Protein Properties Length: 412aa    MW: 46033.8 Da    PI: 6.9065
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf09414g00008.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY646.73.3e-19713951386
                   FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseap.........leaaaaaaarklreleelfkayGvryltvakiaelGftvs 76 
                               mdpeafsa+lfkwdpr a+ +pp+rlle a+++++p         l+aa ++ +r+l +leelf+ayG+ry+t+akiaelGftv+
  Niben101Scf09414g00008.1   1 MDPEAFSANLFKWDPRGAM-PPPTRLLEAAVAPPHPppalpppqpLSAAYSIRTRELGGLEELFQAYGIRYYTAAKIAELGFTVN 84 
                               9**************9877.67778888877777665676554434444444555566*************************** PP

                   FLO_LFY  77 tLvdmkdeelddlmkslseifrldllvGeryGikaavraerrrleeeeaekkrrkllsedeetaldalsqeglseepvqe.ekea 160
                               tL+dmkdeeldd+m+sls+ifr++llvGeryGikaa+raerrrleeee  ++r +lls+  ++aldalsqeglseepvq+ e+ea
  Niben101Scf09414g00008.1  85 TLLDMKDEELDDMMNSLSQIFRWELLVGERYGIKAAIRAERRRLEEEE-LRRRGHLLSDGGTNALDALSQEGLSEEPVQQqEREA 168
                               **********************************************88.8888899999999****************9945567 PP

                   FLO_LFY 161 agsggeglgeaelvaaee..kkseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedgeerqrehPfivtepgevar 243
                               +gsgg+g +++e+vaa+   + +++++kk  ++ ++r+   ++ ++e+++e +e+d + +++g + +erqrehPfivtepgevar
  Niben101Scf09414g00008.1 169 VGSGGGG-TTWEVVAAAGggRMKQRRRKKVVAAGRERRGGASADEDEETEEGQEDDWNINDAGGGISERQREHPFIVTEPGEVAR 252
                               7777766.89999988775333333344443333333333333333444444455555566777778****************** PP

                   FLO_LFY 244 gkknGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafke 328
                               gkknGLDYLf+LyeqCr+fL+qvq+iakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafke
  Niben101Scf09414g00008.1 253 GKKNGLDYLFHLYEQCRDFLIQVQNIAKERGEKCPTKVTNQVFRYAKKAGASYINKPKMRHYVHCYALHCLDEEASNALRRAFKE 337
                               ************************************************************************************* PP

                   FLO_LFY 329 rgenvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                               rgenvGawrqacykplvaiaarqgwdid++fnahprL+iWYvPtkLrqLCh ers+a+
  Niben101Scf09414g00008.1 338 RGENVGAWRQACYKPLVAIAARQGWDIDTIFNAHPRLAIWYVPTKLRQLCHSERSNAA 395
                               *******************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016982.0E-2101395IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MDPEAFSANL FKWDPRGAMP PPTRLLEAAV APPHPPPALP PPQPLSAAYS IRTRELGGLE  60
ELFQAYGIRY YTAAKIAELG FTVNTLLDMK DEELDDMMNS LSQIFRWELL VGERYGIKAA  120
IRAERRRLEE EELRRRGHLL SDGGTNALDA LSQEGLSEEP VQQQEREAVG SGGGGTTWEV  180
VAAAGGGRMK QRRRKKVVAA GRERRGGASA DEDEETEEGQ EDDWNINDAG GGISERQREH  240
PFIVTEPGEV ARGKKNGLDY LFHLYEQCRD FLIQVQNIAK ERGEKCPTKV TNQVFRYAKK  300
AGASYINKPK MRHYVHCYAL HCLDEEASNA LRRAFKERGE NVGAWRQACY KPLVAIAARQ  360
GWDIDTIFNA HPRLAIWYVP TKLRQLCHSE RSNAAAASSS VSVGVGDHLP HF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1092344053174PROTEIN LEAFY
2vy2_A1e-1092344053174PROTEIN LEAFY
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that act to specify determinacy in the progenitor cells for both flowers and leaves.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009780579.10.0PREDICTED: floricaula/leafy homolog 2 isoform X2
RefseqXP_016449328.10.0PREDICTED: floricaula/leafy homolog 2
SwissprotQ405050.0FL2_TOBAC; Floricaula/leafy homolog 2
TrEMBLA0A1S3YBE10.0A0A1S3YBE1_TOBAC; floricaula/leafy homolog 2
TrEMBLA0A1U7X1290.0A0A1U7X129_NICSY; floricaula/leafy homolog 2 isoform X2
STRINGXP_009780578.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA66682333
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.11e-145floral meristem identity control protein LEAFY (LFY)