PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf09365g00027.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 313aa    MW: 34648.5 Da    PI: 6.2254
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf09365g00027.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260125.62.5e-39101101101
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               aCaaCk++rr+C++dC+lapyfpa+qpk f+n+h+lFG+sn+lk+lk+l++++++ am+s++y+A+ar + PvyG+v+ i++l  
  Niben101Scf09365g00027.1  10 ACAACKYQRRRCSSDCPLAPYFPADQPKMFQNAHRLFGVSNILKILKQLDPSQKKGAMKSIIYQANARDKHPVYGCVAEIQNLVF 94 
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaelallkeel 101
                               +++  ++el++++++l
  Niben101Scf09365g00027.1  95 NIQLYEEELQAVHAQL 110
                               ***********99885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.4929110IPR004883Lateral organ boundaries, LOB
PfamPF031957.6E-3810107IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 313 aa     Download sequence    Send to blast
MTLKGGTSQA CAACKYQRRR CSSDCPLAPY FPADQPKMFQ NAHRLFGVSN ILKILKQLDP  60
SQKKGAMKSI IYQANARDKH PVYGCVAEIQ NLVFNIQLYE EELQAVHAQL AFYRQQQQHQ  120
QQEISSTALS DSVSHIQLGM PPPPAVAPPP PPPQPANGNG LTLFHQDAPS QQYNAAVNAN  180
ALPVQSYPSY SNNSYAAYNN NTTFVDPKEN NVVNSLWIQQ SYGNSACNNN TMIMQSQLPS  240
SQAISVPPEV TQDYDDIHPF FDTIDDRKSY IDSKEAYDSS SESSLKDTRH SVEHVAENEL  300
KSAAACFTLT SVN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-2961137114LOB family transfactor Ramosa2.1
5ly0_B3e-2961137114LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019244725.10.0PREDICTED: LOB domain-containing protein 27-like
TrEMBLA0A1J6J4U10.0A0A1J6J4U1_NICAT; Lob domain-containing protein 27
STRINGXP_009777754.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14492375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.13e-52LOB domain-containing protein 27