PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf09363g00022.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 605aa    MW: 65935.8 Da    PI: 6.9589
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf09363g00022.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA512e-16493527135
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                               C +C + kTp+WR gp g+ktLCnaCG++y++ +l
  Niben101Scf09363g00022.1 493 CLHCASEKTPQWRTGPMGPKTLCNACGVRYKSGRL 527
                               99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011412.479487523IPR000679Zinc finger, GATA-type
SMARTSM004012.9E-16487537IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.61E-14489550No hitNo description
Gene3DG3DSA:3.30.50.101.8E-13489524IPR013088Zinc finger, NHR/GATA-type
CDDcd002022.64E-12492539No hitNo description
PfamPF003202.6E-14493527IPR000679Zinc finger, GATA-type
PROSITE patternPS003440493518IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MIIVKLQIRP LLQYEKPSDP DPLLSALEHL SVLFTLNSFI LSSFFSAFLF NYSQRNRYFA  60
SLKRLTLSIL RLSQTFFLPM EASDFFVSGY FSNAGDEKSP NNNNNNNNNN FTVDDLLDFS  120
KEDEVMTDAF FDSITGNSAD SSTVTVVDSC NSSVSGENGH FNGNLSCRSF TDAPFPSSEL  180
CVPYDDLAEL EWLSNFVEES FSSDDVQNLQ LIPVTNINST ANNTTDSSSS ATTISAGTNS  240
PPAFPADTSV PGKVRSKRSR AAPCDWSSRL QLLLSPTTSS SESNNSAANN NTSATAKATK  300
APSKKRESVE TPGRKCLHCA SEKTPHCNSS VSGENGHFNG NLSCRSFTDA PFPSSELCVP  360
YDDLAELEWL SNFVEESFSS DDVQNLQLIP VTNINSTANN TTDSSSSATT ISAGTNSPPA  420
FPADTSVPGK VRSKRSRAAP CDWSSRLQLL LSPTTSSSES NNSAANSNTS ATAKATKAPS  480
KKRESVETPG RKCLHCASEK TPQWRTGPMG PKTLCNACGV RYKSGRLVPE YRPAASPTFV  540
SAKHSNSHRK VLELRRQKEF QRHPAHHHQH QLISQTSIFG VSKGGDDFLL HHHQQNCGPN  600
FRHLI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009628152.10.0PREDICTED: GATA transcription factor 12-like
RefseqXP_016470527.10.0PREDICTED: GATA transcription factor 12-like
TrEMBLK4BMN81e-152K4BMN8_SOLLC; Uncharacterized protein
STRINGSolyc03g120890.2.11e-151(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA19192363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25830.11e-68GATA transcription factor 12