PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf09192g01004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GATA
Protein Properties Length: 289aa    MW: 31842.9 Da    PI: 8.071
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf09192g01004.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA61.51e-19207241135
                      GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                               C++Cg+ kTp+WR gp g+ktLCnaCG+++++ +l
  Niben101Scf09192g01004.1 207 CQHCGADKTPQWRAGPLGPKTLCNACGVRFKSGRL 241
                               *******************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.978201237IPR000679Zinc finger, GATA-type
SMARTSM004011.1E-16201255IPR000679Zinc finger, GATA-type
SuperFamilySSF577163.52E-15203265No hitNo description
Gene3DG3DSA:3.30.50.101.5E-14204239IPR013088Zinc finger, NHR/GATA-type
CDDcd002025.81E-15206255No hitNo description
PROSITE patternPS003440207232IPR000679Zinc finger, GATA-type
PfamPF003202.6E-17207241IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007623Biological Processcircadian rhythm
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MKMEALDPSA ASCFMVDVDD DLLNFSLEDE TVLDDDEKTT NSITKHTHPF SSSYSSSLDS  60
SNPVLSLLPS QQHPECIEEE LEWLSNKDAF PAVEFGILAD NPNIVFDHHS PVSVLENSSS  120
TCNSSGTSSA NANAYMSCCA SLKVPVNYPV RARSKRRRRR RRGSFADLPS EHCMLVNKPS  180
FKSFKQHEPL LSLPVNSAKS ASIGRRCQHC GADKTPQWRA GPLGPKTLCN ACGVRFKSGR  240
LLPEYRPANS PTFSPTVHSN SHRKVLEMRK QKIGVGGMMI HEACGYRVG
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1152161RSKRRRRRRR
2154159KRRRRR
3155161RRRRRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00377DAPTransfer from AT3G24050Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009767386.10.0PREDICTED: GATA transcription factor 1-like
TrEMBLQ76DY20.0Q76DY2_TOBAC; AG-motif binding protein-2
STRINGPGSC0003DMT4000302741e-134(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA40762445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24050.12e-43GATA transcription factor 1