PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf09038g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TCP
Protein Properties Length: 178aa    MW: 19829.5 Da    PI: 8.7314
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf09038g00001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP85.61.2e-26100163265
                       TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgt 65 
                               a kk rhski T+ g Rd R+Rls+++a +fF Lqd  Gf k+skt+eWLl+++k a+ e    
  Niben101Scf09038g00001.1 100 AYKKYRHSKINTAHGCRDQRMRLSLDVAHKFFNLQDLFGFNKASKTVEWLLTKSKSAVNEVFHG 163
                               789*******************************************************998665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036343.1E-29102167IPR005333Transcription factor, TCP
PROSITE profilePS5136927.365102160IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 178 aa     Download sequence    Send to blast
MVHIHGDSAS NRNKETLQIT VLQINSGLVL LVKNTSVEVP CKYPATFCLT SNYQLAVVTS  60
LAADSNKDIV ISSTNQDPEE VEIQGSCKNK KGDNKRVAAA YKKYRHSKIN TAHGCRDQRM  120
RLSLDVAHKF FNLQDLFGFN KASKTVEWLL TKSKSAVNEV FHGINKENCS TANEIELD
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019244778.14e-63PREDICTED: transcription factor DICHOTOMA-like
TrEMBLA0A1J6JE481e-61A0A1J6JE48_NICAT; Transcription factor teosinte branched 1
STRINGXP_009787900.13e-58(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24822256
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67260.21e-22TCP family protein