PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf08755g01011.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TCP
Protein Properties Length: 78aa    MW: 8813.94 Da    PI: 8.7996
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf08755g01011.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP63.76.7e-203578548
                       TCP  5 kdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdskti 48
                              k    k hTkv+gR+RR+ ++a+ca r+F+L++e G+++d++ti
  Niben101Scf08755g01011.1 35 KEDETKKHTKVEGRGRRISMPALCATRIFQLTRESGHKSDGETI 78
                              4456688************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136914.4743578IPR017887Transcription factor TCP subgroup
PfamPF036344.8E-133978IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 78 aa     Download sequence    Send to blast
MDPKQPPTQS NAININNSNN NIMVECNKPI HDQIKEDETK KHTKVEGRGR RISMPALCAT  60
RIFQLTRESG HKSDGETI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019238938.11e-30PREDICTED: transcription factor TCP20-like
SwissprotO646474e-17TCP9_ARATH; Transcription factor TCP9
TrEMBLA0A1J6KHQ43e-29A0A1J6KHQ4_NICAT; Transcription factor tcp20
STRINGXP_009624132.11e-29(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24824201
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45680.17e-19TCP family protein