PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf08504g02005.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TCP
Protein Properties Length: 117aa    MW: 13323.3 Da    PI: 10.5129
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf08504g02005.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP91.41.9e-2840102264
                       TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltg 64 
                               a kk rhski T+ g+Rd R+Rls+++a+++F Lqd LGfdk+skt eWLl ++k a+ e ++
  Niben101Scf08504g02005.1  40 AYKKNRHSKINTAHGPRDQRMRLSLDVARKLFNLQDFLGFDKASKTMEWLLIKSKSAVNEVVR 102
                               789*******************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136928.5542100IPR017887Transcription factor TCP subgroup
PfamPF036341.9E-3042103IPR005333Transcription factor, TCP
Sequence ? help Back to Top
Protein Sequence    Length: 117 aa     Download sequence    Send to blast
MAAYSNKDIV ISSTNQDPEE VEIQGIFKNR KGDNKRVAAA YKKNRHSKIN TAHGPRDQRM  60
RLSLDVARKL FNLQDFLGFD KASKTMEWLL IKSKSAVNEV VRGIKAAIEI ENKISNY
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the dorsovental asymmetry of flowers. Retards growth rate and reduces organ number in the dorsal region of flowers (By similarity). {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019244778.15e-56PREDICTED: transcription factor DICHOTOMA-like
SwissprotQ9SBV94e-23CYCLD_ANTMH; Transcription factor CYCLOIDEA (Fragment)
TrEMBLA0A1J6JE481e-54A0A1J6JE48_NICAT; Transcription factor teosinte branched 1
STRINGXP_009787900.16e-53(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24822256
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G67260.27e-24TCP family protein
Publications ? help Back to Top
  1. Vieira CP,Vieira J,Charlesworth D
    Evolution of the cycloidea gene family in Antirrhinum and Misopates.
    Mol. Biol. Evol., 1999. 16(11): p. 1474-83
    [PMID:10555278]
  2. Gubitz T,Caldwell A,Hudson A
    Rapid molecular evolution of CYCLOIDEA-like genes in Antirrhinum and its relatives.
    Mol. Biol. Evol., 2003. 20(9): p. 1537-44
    [PMID:12832647]