PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf07991g03004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 652aa    MW: 73647.9 Da    PI: 6.5826
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf07991g03004.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.4e-094504871954
                               HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                  Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                               Fe   ++yps++++  L++++gL+++qV++WF N R +
  Niben101Scf07991g03004.1 450 FEHflHPYPSEADKHLLSRQTGLSKNQVSNWFINARVR 487
                               554459******************************88 PP

2BELL73.24.3e-243303812172
                      BELL  21 krYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                               k Y +y+eq+q++++sF+ ++g+g+a+pYt+lA+ka+SrhFrc+kdai+ q+
  Niben101Scf07991g03004.1 330 KLYMRYCEQMQAMVNSFNSMIGYGAAAPYTALAQKAMSRHFRCIKDAIVTQL 381
                               5699*********************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.1E-42255379IPR006563POX domain
PfamPF075264.9E-34260378IPR006563POX domain
PROSITE profilePS5007112.422428491IPR001356Homeobox domain
SMARTSM003891.8E-9431495IPR001356Homeobox domain
CDDcd000861.78E-11431492No hitNo description
SuperFamilySSF466896.84E-17432498IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-28434497IPR009057Homeodomain-like
PfamPF059207.1E-18448487IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 652 aa     Download sequence    Send to blast
MSQRFQQEFY NFSSVYERSA TKHEDMLRIQ GFEPLPPPPH QVEEPSGEVY DGGGMLTEII  60
SYPSAWRKAA TEMLDDQIQS SNYRQWPEKE QQQQLPPSLN EVELPLMNSH IKASSPPRSS  120
SSLHMLLPNS TDTNNLLHHQ GFHLLNSSTV EPPSQFTWVP GSSSGEDNST RIGRVVDGQG  180
LSLSLSRNFE TSAKMEDLRM GNGGIYLSNN QGLFGAINNN SSHHHQQLLH SGVIMDHRTP  240
HSNHQVHVGY AAASPRMTNV LRNSRYVKAA QELLEEFCCV GRGNYKNQRV KKYEDENPNS  300
NAESEDPGSS KDHPPLSAAE RSEYQRRKIK LYMRYCEQMQ AMVNSFNSMI GYGAAAPYTA  360
LAQKAMSRHF RCIKDAIVTQ LKQTCKYLGE KDVTGSGGLT KGETPRLKIL DQKLRQQKAL  420
HQMGMLDSDA WRPQRGLPER SVNVLRAWLF EHFLHPYPSE ADKHLLSRQT GLSKNQVSNW  480
FINARVRLWK PMVEEMYQQE TKEEETDQDQ DQDQEEEEQE NQLSAQTPMH DKINNMATSA  540
TTTTMPLSVR SEFNANERDL SKNIINYRQY ALGNQLVMLQ DDTATASSAT HDVSTTVNRY  600
FTAADAADLV ANSNGAFGSQ PAGDVSLTLG LRHSENLPRK TTQFQLRDFG AY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B1e-16437495563Homeobox protein Meis2
3k2a_A1e-16437495563Homeobox protein Meis2
4xrm_B1e-16437495563Homeobox protein Meis2
4xrm_A1e-16437495563Homeobox protein Meis2
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009773433.10.0PREDICTED: BEL1-like homeodomain protein 4
RefseqXP_016504574.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLK4BV620.0K4BV62_SOLLC; Uncharacterized protein
STRINGSolyc04g079830.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60721721
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-116BEL1-like homeodomain 2