PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf07894g01004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family G2-like
Protein Properties Length: 115aa    MW: 13313 Da    PI: 9.8181
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf07894g01004.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.25.2e-3054107255
                   G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                               prlrWtp+LH +Fv+a+e+L G+e+AtPk +l++m+v gL+++hvkSHLQ+YR+
  Niben101Scf07894g01004.1  54 PRLRWTPDLHLSFVRAIERLDGQERATPKLVLQTMNVRGLSIAHVKSHLQMYRS 107
                               8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.1E-2850108IPR009057Homeodomain-like
PROSITE profilePS512949.16250110IPR017930Myb domain
SuperFamilySSF466892.87E-1452108IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-2254109IPR006447Myb domain, plants
PfamPF002493.9E-755106IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MSYSSDLNEE SNDAIGLRDD MIEKTAEGNS SFEDIGNYEN KRSRVRQYVR SKLPRLRWTP  60
DLHLSFVRAI ERLDGQERAT PKLVLQTMNV RGLSIAHVKS HLQMYRSKKL GEFGQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-1955109458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-1955109458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-1955109458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-1955109458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-1955109458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-1955109458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-1955109458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-1955109458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription factor.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_018628204.12e-65PREDICTED: putative Myb family transcription factor At1g14600 isoform X2
SwissprotQ700D98e-27MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLA0A1J6K8345e-64A0A1J6K834_NICAT; Putative myb family transcription factor
STRINGXP_009607761.11e-64(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-39G2-like family protein