PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf07883g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 203aa    MW: 22970.8 Da    PI: 8.4551
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf07883g00004.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260112.43.2e-359103195
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               aCa+Ck++r+kCa+ C+lapyfpa+++++f++vhk+FG+snv+kl+kal+ee+r++a++slv+ A +r+rdPv G++g ++++ +
  Niben101Scf07883g00004.1   9 ACASCKYQRKKCADTCILAPYFPADKNQEFQAVHKIFGVSNVTKLIKALNEEDRKKAADSLVWDAFCRQRDPVLGSYGEYRRVAE 93 
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaela 95 
                               +l+  k++ +
  Niben101Scf07883g00004.1  94 ELKLYKSQYQ 103
                               **99998866 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.5188109IPR004883Lateral organ boundaries, LOB
PfamPF031959.8E-349104IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 203 aa     Download sequence    Send to blast
MQKSRDTAAC ASCKYQRKKC ADTCILAPYF PADKNQEFQA VHKIFGVSNV TKLIKALNEE  60
DRKKAADSLV WDAFCRQRDP VLGSYGEYRR VAEELKLYKS QYQQILQIPS QGATGLMYNA  120
AQGLNNGYNN RANSIMESWP CSNNIHLQHV QNMEKLRSDS NGSTNIVPQQ AIDGYTNHYY  180
LTAGNCNPID VKRMENSLWE ASS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-228861088LOB family transfactor Ramosa2.1
5ly0_B2e-228861088LOB family transfactor Ramosa2.1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009790364.11e-129PREDICTED: LOB domain-containing protein 27-like
RefseqXP_016466095.11e-129PREDICTED: LOB domain-containing protein 27-like
TrEMBLA0A1J6IU411e-144A0A1J6IU41_NICAT; Lob domain-containing protein 2
STRINGXP_009790364.11e-128(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA101771827
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06280.11e-47LOB domain-containing protein 2