PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf07817g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 232aa    MW: 26107.6 Da    PI: 7.5345
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf07817g00001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260138.81.9e-4371061100
                    DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqq 85 
                               +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv kll++l+ ++reda++sl+yeAe r+rdPvyG+vg+i+ lq+
  Niben101Scf07817g00001.1   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNELNATQREDAVNSLAYEAEYRLRDPVYGCVGLISVLQH 91 
                               7************************************************************************************ PP

                    DUF260  86 qleqlkaelallkee 100
                               +l+q++ +l  +k+e
  Niben101Scf07817g00001.1  92 KLKQVQDDLLNAKKE 106
                               ********9888876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7576107IPR004883Lateral organ boundaries, LOB
PfamPF031953.6E-437103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 232 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK LLNELNATQR  60
EDAVNSLAYE AEYRLRDPVY GCVGLISVLQ HKLKQVQDDL LNAKKELATY IGPSAMLPIL  120
QHPGYIQQHP NNPSSSTMMP YNMQPMLGLP TGMQQQQQQH GAQLMLRDPQ QQQQQNQQQV  180
IEAHQLAAAM AAREQQDMLR TYEQQPQQQQ HPQFNSGYAT SFSLTFLSVA DA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-5031107114LOB family transfactor Ramosa2.1
5ly0_B3e-5031107114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_019234324.11e-132PREDICTED: LOB domain-containing protein 36-like isoform X2
SwissprotQ9FKZ34e-77LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A1J6K9Q51e-130A0A1J6K9Q5_NICAT; Lob domain-containing protein 36
STRINGXP_009774046.11e-131(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.13e-79ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]